Product Number |
ARP34673_T100 |
Product Page |
www.avivasysbio.com/creb3l2-antibody-n-terminal-region-arp34673-t100.html |
Name |
CREB3L2 Antibody - N-terminal region (ARP34673_T100) |
Protein Size (# AA) |
520 amino acids |
Molecular Weight |
57 kDa |
NCBI Gene Id |
64764 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
CAMP responsive element binding protein 3-like 2 |
Description |
|
Alias Symbols |
BBF2H7 |
Peptide Sequence |
Synthetic peptide located within the following region: HSYSLCEEPRAQSPFTHITSDSFNDDEVESEKWYLSTDF |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Storlazzi,C.T., et al., (2003) Hum. Mol. Genet. 12 (18), 2349-2358 |
Description of Target |
CREB3L2 is a member of the old astrocyte specifically induced substance (OASIS) DNA binding and basic leucine zipper dimerization (bZIP) family of transcription factors, which includes CREB3 (MIM 606443) and CREB4 (MIM 607138). |
Protein Interactions |
Fbxw7; UBE2D3; UBA1; GAS7; UBC; GCFC2; RGS16; PXN; CEP19; GULP1; RND1; ZNF212; PTP4A1; ELAVL1; SUMO2; Dynll1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Enhanced Validation |
|
Datasheets/Manuals |
Printable datasheet for anti-CREB3L2 (ARP34673_T100) antibody |
Blocking Peptide |
For anti-CREB3L2 (ARP34673_T100) antibody is Catalog # AAP34673 (Previous Catalog # AAPP05863) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human CREB3L2 |
Uniprot ID |
Q70SY1 |
Protein Name |
Cyclic AMP-responsive element-binding protein 3-like protein 2 |
Publications |
CREB3L1-mediated functional and structural adaptation of the secretory pathway in hormone-stimulated thyroid cells. J Cell Sci. 130, 4155-4167 (2017). 29093023
Fox, R. M., Hanlon, C. D. & Andrew, D. J. The CrebA/Creb3-like transcription factors are major and direct regulators of secretory capacity. J. Cell Biol. 191, 479-92 (2010). 21041443
Lynch, J. M. et al. A thrombospondin-dependent pathway for a protective ER stress response. Cell 149, 1257-68 (2012). 22682248
Sievert, A. J. et al. Duplication of 7q34 in pediatric low-grade astrocytomas detected by high-density single-nucleotide polymorphism-based genotype arrays results in a novel BRAF fusion gene. Brain Pathol. 19, 449-58 (2009). 19016743 |
Protein Accession # |
NP_919047 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_194071 |
Tested Species Reactivity |
Human |
Gene Symbol |
CREB3L2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 85%; Guinea Pig: 87%; Horse: 87%; Human: 100%; Mouse: 86%; Rabbit: 87%; Rat: 87% |
Image 1 | Human Jurkat
| WB Suggested Anti-CREB3L2 Antibody Titration: 1.25ug/ml ELISA Titer: 1:12500 Positive Control: Jurkat cell lysate |
|
Image 2 | Human kidney
| Human kidney |
|
Image 3 | Human Fetal Muscle
| Host: Rabbit Target Name: CREB3L2 Sample Type: Human Fetal Muscle Antibody Dilution: 1.0ug/ml |
|
Image 4 | Human Fetal Lung
| Host: Rabbit Target Name: CREB3L2 Sample Type: Human Fetal Lung Antibody Dilution: 1.0ug/ml |
|
Image 5 | Human Fetal Heart
| Host: Rabbit Target Name: CREB3L2 Sample Type: Human Fetal Heart Antibody Dilution: 1.0ug/ml |
|
Image 6 | Human Fetal Brain
| Host: Rabbit Target Name: CREB3L2 Sample Type: Human Fetal Brain Antibody Dilution: 1.0ug/ml |
|