| Product Number |
ARP34671_T100 |
| Product Page |
www.avivasysbio.com/rcor2-antibody-n-terminal-region-arp34671-t100.html |
| Name |
RCOR2 Antibody - N-terminal region (ARP34671_T100) |
| Protein Size (# AA) |
523 amino acids |
| Molecular Weight |
58kDa |
| NCBI Gene Id |
283248 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
REST corepressor 2 |
| Peptide Sequence |
Synthetic peptide located within the following region: YYYSWKKTRSRTSVMDRQARRLGGRKDKEDSDELEEGRGGVSEGEPDPAD |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Maruyama,K. Unpublished (2002) |
| Description of Target |
RCOR2 may act as a component of a corepressor complex that represses transcription. |
| Protein Interactions |
HDAC11; HDAC2; HDAC1; SUMO2; ARR3; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-RCOR2 (ARP34671_T100) antibody |
| Blocking Peptide |
For anti-RCOR2 (ARP34671_T100) antibody is Catalog # AAP34671 (Previous Catalog # AAPP23634) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human RCOR2 |
| Uniprot ID |
Q8IZ40 |
| Protein Name |
REST corepressor 2 |
| Protein Accession # |
NP_775858 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_173587 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
RCOR2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 93%; Guinea Pig: 92%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 86%; Rat: 93% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-RCOR2 Antibody Titration: 5.0ug/ml
Positive Control: Jurkat cell lysate |
|
|
