| Product Number |
ARP34654_P050 |
| Product Page |
www.avivasysbio.com/trim6-antibody-n-terminal-region-arp34654-p050.html |
| Name |
TRIM6 Antibody - N-terminal region (ARP34654_P050) |
| Protein Size (# AA) |
516 amino acids |
| Molecular Weight |
59kDa |
| NCBI Gene Id |
117854 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Tripartite motif containing 6 |
| Alias Symbols |
RNF89 |
| Peptide Sequence |
Synthetic peptide located within the following region: CWLCERSQEHRGHHTFLVEEVAQEYQEKFQESLKKLKNEEQEAEKLTAFI |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Li,X., (2006) J. Virol. 80 (13), 6198-6206 |
| Description of Target |
TRIM6 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to the nucleus, but its specific function has not been identified.The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to the nucleus, but its specific function has not been identified. This gene is mapped to chromosome 11p15, where it resides within a TRIM gene cluster. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. A read-through transcript transcribed from this gene and TRIM34 has been observed. |
| Protein Interactions |
IKBKE; UBC; TRIM5; TRIM6; MYC; TRIM28; TRIM23; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-TRIM6 (ARP34654_P050) antibody |
| Blocking Peptide |
For anti-TRIM6 (ARP34654_P050) antibody is Catalog # AAP34654 (Previous Catalog # AAPP05844) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human TRIM6 |
| Uniprot ID |
A8K2A7 |
| Protein Name |
Tripartite motif-containing protein 6 |
| Protein Accession # |
NP_001003818 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001003818 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
TRIM6 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 79%; Horse: 83%; Human: 100%; Mouse: 79%; Pig: 79%; Rabbit: 79%; Rat: 79% |
| Image 1 | Human 293T
 | WB Suggested Anti-TRIM6 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 293T cell lysate |
|
