KLHL13 Antibody - N-terminal region (ARP34652_P050)

Data Sheet
 
Product Number ARP34652_P050
Product Page www.avivasysbio.com/klhl13-antibody-n-terminal-region-arp34652-p050.html
Name KLHL13 Antibody - N-terminal region (ARP34652_P050)
Protein Size (# AA) 655 amino acids
Molecular Weight 74kDa
NCBI Gene Id 90293
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Kelch-like 13 (Drosophila)
Alias Symbols BKLHD2
Peptide Sequence Synthetic peptide located within the following region: KTSSPAIWKFPVPVLKTSRSTPLSPAYISLVEEEDQHMKLSLGGSEMGLS
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Nagase T,. DNA Res. 2000 Feb 28;7(1):65-73.
Description of Target KLHL13 contains 6 Kelch repeats and 1 BTB (POZ) domain. The function of this protein remains unknown
Protein Interactions KLHL22; KLHL9; KLHL21; NEDD8; HSP90AA1; UBC; CUL3; UBE2D1; DCUN1D1; COPS5; COPS6; AURKB; UBXN7; USP25; COPS4; NUDCD3; COPS2; ZMYM6; ZMYM4; USP11; MAD2L1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-KLHL13 (ARP34652_P050) antibody
Blocking Peptide For anti-KLHL13 (ARP34652_P050) antibody is Catalog # AAP34652 (Previous Catalog # AAPP05842)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human KLHL13
Uniprot ID Q9P2N7
Protein Name Kelch-like protein 13
Protein Accession # NP_277030
Purification Affinity Purified
Nucleotide Accession # NM_033495
Tested Species Reactivity Human
Gene Symbol KLHL13
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human Jurkat
WB Suggested Anti-KLHL13 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate
Image 2
Human Intestine
Human Intestine
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com