PSIP1 Antibody - middle region (ARP34644_T100)

Data Sheet
 
Product Number ARP34644_T100
Product Page www.avivasysbio.com/psip1-antibody-middle-region-arp34644-t100.html
Name PSIP1 Antibody - middle region (ARP34644_T100)
Protein Size (# AA) 530 amino acids
Molecular Weight 60kDa
NCBI Gene Id 11168
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name PC4 and SFRS1 interacting protein 1
Alias Symbols p52, p75, PAIP, DFS70, LEDGF, PSIP2
Peptide Sequence Synthetic peptide located within the following region: AADRKRKQEEQMETEQQNKDEGKKPEVKKVEKKRETSMDSRLQRIHAEIK
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Vandegraaff,N., et al., (2006) Virology 346 (2), 415-426
Description of Target PSIP1 is a transcriptional coactivator. It also acts as an adaptor to coordinate pre-mRNA splicing and transcriptional activation of class II genes.
Protein Interactions PPP2R1A; UBC; RPA3; RPA2; RPA1; HMGA2; HMGA1; WHSC1; CSNK2A1; gag-pol; ESR1; ZC3H18; FTSJ3; EXOSC5; EXOSC4; NCSTN; RRS1; SUPT16H; SAP18; THRAP3; EIF4A3; U2AF1; TPBG; SON; TRA2B; RPS24; RPS11; RPL6; CAST; SH3KBP1; MEN1; SUMO1; SUMO2; HDGF; MAPK6; KMT2A; BA
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-PSIP1 (ARP34644_T100) antibody
Blocking Peptide For anti-PSIP1 (ARP34644_T100) antibody is Catalog # AAP34644
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human PSIP1
Uniprot ID O75475
Protein Name PC4 and SFRS1-interacting protein
Sample Type Confirmation

PSIP1 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

Protein Accession # NP_150091
Purification Protein A purified
Nucleotide Accession # NM_033222
Tested Species Reactivity Human
Gene Symbol PSIP1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
Image 1
Human Lung
Rabbit Anti-PSIP1 antibody
Catalog Number: ARP34644_T100
Paraffin Embedded Tissue: Human Lung cell
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
Image 2
Human Jurkat
WB Suggested Anti-PSIP1 Antibody
Titration: 5 ug/ml
Positive Control: Jurkat Whole CellPSIP1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells
Image 3
Human Jurkat
Human Jurkat
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com