Product Number |
ARP34642_T100 |
Product Page |
www.avivasysbio.com/znf289-antibody-n-terminal-region-arp34642-t100.html |
Name |
ZNF289 Antibody - N-terminal region (ARP34642_T100) |
Protein Size (# AA) |
521 amino acids |
Molecular Weight |
57kDa |
NCBI Gene Id |
84364 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
ADP-ribosylation factor GTPase activating protein 2 |
Alias Symbols |
IRZ, ZFP289, ZNF289, NBLA10535 |
Peptide Sequence |
Synthetic peptide located within the following region: YREKIRQLGSAALARHGTDLWIDNMSSAVPNHSPEKKDSDFFTEHTQPPA |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Singh,J., et al., (2001) J. Biol. Chem. 276 (15), 11852-11858 |
Description of Target |
ZNF289 is a candidate transcription factor |
Protein Interactions |
UBC; VCP; ESR1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ARFGAP2 (ARP34642_T100) antibody |
Blocking Peptide |
For anti-ARFGAP2 (ARP34642_T100) antibody is Catalog # AAP34642 (Previous Catalog # AAPP05832) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF289 |
Uniprot ID |
Q8N6H7 |
Protein Name |
ADP-ribosylation factor GTPase-activating protein 2 |
Sample Type Confirmation |
ARFGAP2 is supported by BioGPS gene expression data to be expressed in HepG2 |
Protein Accession # |
NP_115765 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_032389 |
Tested Species Reactivity |
Human |
Gene Symbol |
ARFGAP2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
Image 1 | Human HepG2
| WB Suggested Anti-ZNF289 Antibody Titration: 1.5ug/ml ELISA Titer: 1:62500 Positive Control: HepG2 cell lysateARFGAP2 is supported by BioGPS gene expression data to be expressed in HepG2 |
|