Product Number |
ARP34641_P050 |
Product Page |
www.avivasysbio.com/rnf135-antibody-middle-region-arp34641-p050.html |
Name |
RNF135 Antibody - middle region (ARP34641_P050) |
Protein Size (# AA) |
432 amino acids |
Molecular Weight |
48kDa |
NCBI Gene Id |
84282 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Ring finger protein 135 |
Alias Symbols |
L13, MMFD, REUL, Riplet |
Peptide Sequence |
Synthetic peptide located within the following region: DILHDLEEIQEKLQESVTWKEAPEAQMQGELLEAPSSSSCPLPDQSHPAL |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Petroziello,J., (2004) Oncogene 23(46), 7734-45 |
Description of Target |
The protein encoded by RNF135 contains a RING finger domain, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. This gene is located in a chromosomal region known to be frequently deleted in patients with neurofibromatosis. |
Protein Interactions |
RNF135; CTNNAL1; GOLGA2; DDX58; UBE2D2; UBD; RARRES3; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-RNF135 (ARP34641_P050) antibody |
Blocking Peptide |
For anti-RNF135 (ARP34641_P050) antibody is Catalog # AAP34641 (Previous Catalog # AAPP05831) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human RNF135 |
Uniprot ID |
Q8IUD6 |
Protein Name |
E3 ubiquitin-protein ligase RNF135 |
Protein Accession # |
NP_115698 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_032322 |
Tested Species Reactivity |
Human |
Gene Symbol |
RNF135 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 92%; Dog: 92%; Guinea Pig: 91%; Horse: 77%; Human: 100%; Mouse: 86%; Rat: 83% |
Image 1 | Human Jurkat
| WB Suggested Anti-RNF135 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: Jurkat cell lysate |
|
Image 2 | Human OVCAR-3 Whole Cell
| Host: Rabbit Target Name: RNF135 Sample Tissue: Human OVCAR-3 Whole Cell Antibody Dilution: 1ug/ml |
|
Image 3 | Human Placenta, HeLa
| Host: Rabbit Target: RNF135 Positive control (+): Human Placenta (PL) Negative control (-): HeLa (HL) Antibody concentration: 1ug/ml |
|
Image 4 | Human THP-1 Whole Cell
| Host: Rabbit Target Name: RNF135 Sample Tissue: Human THP-1 Whole Cell Antibody Dilution: 3ug/ml |
|