RNF135 Antibody - middle region (ARP34641_P050)

Data Sheet
 
Product Number ARP34641_P050
Product Page www.avivasysbio.com/rnf135-antibody-middle-region-arp34641-p050.html
Name RNF135 Antibody - middle region (ARP34641_P050)
Protein Size (# AA) 432 amino acids
Molecular Weight 48kDa
NCBI Gene Id 84282
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Ring finger protein 135
Alias Symbols L13, MMFD, REUL, Riplet
Peptide Sequence Synthetic peptide located within the following region: DILHDLEEIQEKLQESVTWKEAPEAQMQGELLEAPSSSSCPLPDQSHPAL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Petroziello,J., (2004) Oncogene 23(46), 7734-45
Description of Target The protein encoded by RNF135 contains a RING finger domain, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. This gene is located in a chromosomal region known to be frequently deleted in patients with neurofibromatosis.
Protein Interactions RNF135; CTNNAL1; GOLGA2; DDX58; UBE2D2; UBD; RARRES3;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-RNF135 (ARP34641_P050) antibody
Blocking Peptide For anti-RNF135 (ARP34641_P050) antibody is Catalog # AAP34641 (Previous Catalog # AAPP05831)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human RNF135
Uniprot ID Q8IUD6
Protein Name E3 ubiquitin-protein ligase RNF135
Protein Accession # NP_115698
Purification Affinity Purified
Nucleotide Accession # NM_032322
Tested Species Reactivity Human
Gene Symbol RNF135
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 92%; Dog: 92%; Guinea Pig: 91%; Horse: 77%; Human: 100%; Mouse: 86%; Rat: 83%
Image 1
Human Jurkat
WB Suggested Anti-RNF135 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate
Image 2
Human OVCAR-3 Whole Cell
Host: Rabbit
Target Name: RNF135
Sample Tissue: Human OVCAR-3 Whole Cell
Antibody Dilution: 1ug/ml
Image 3
Human Placenta, HeLa
Host: Rabbit
Target: RNF135
Positive control (+): Human Placenta (PL)
Negative control (-): HeLa (HL)
Antibody concentration: 1ug/ml
Image 4
Human THP-1 Whole Cell
Host: Rabbit
Target Name: RNF135
Sample Tissue: Human THP-1 Whole Cell
Antibody Dilution: 3ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com