LAS1L Antibody - middle region (ARP34629_P050)

• Product Number: ARP34629_P050
• Name: LAS1L Antibody - middle region (ARP34629_P050)
• Protein Size (# AA): 734 amino acids
• Molecular Weight: 83kDa
• NCBI Gene Id: 81887
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: LAS1-like (S. cerevisiae)
• Alias Symbols: WTS, Las1, Las1-like, dJ475B7.2
• Peptide Sequence: Synthetic peptide located within the following region: SSFGSEAKAQQQEEQGSVNDVKEEEKEEKEVLPDQVEEEEENDDQEEEEE
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: The function of LAS1L has not been determined.
• Protein Interactions: UBC; CEP250; SUMO2; SUMO3; PASK; SUMO1; RNF2; BMI1; SOX2; NOL9; WDR18; TEX10; PELP1; SENP3; IPO5; CBX6; ECT2; BARD1; MDC1; CUL3; CAND1; SIRT7; SMARCAD1; PNKP;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-LAS1L (ARP34629_P050) antibody is Catalog # AAP34629
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human LAS1L
• Uniprot ID: Q9Y4W2
• Protein Name: Ribosomal biogenesis protein LAS1L
• Sample Type Confirmation:

  LAS1L is supported by BioGPS gene expression data to be expressed in COLO205, Hela, HT1080, Jurkat, MCF7, OVCAR3

• Protein Accession #: NP_112483
• Purification: Affinity Purified
• Nucleotide Accession #: NM_031206
• Tested Species Reactivity: Human
• Gene Symbol: LAS1L
• Predicted Species Reactivity: Human, Cow, Horse
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 79%; Horse: 85%; Human: 100%
• Image 1: Human HepG2
  
  WB Suggested Anti-LAS1L Antibody Titration: 0.2-1 ug/ml
  Positive Control: HepG2 cell lysate
• Image 2: Human COLO205
  
  Host: Rabbit
  Target Name: LAS1L
  Sample Type: COLO205
  Antibody Dilution: 1.0ug/mlLAS1L is supported by BioGPS gene expression data to be expressed in COLO205
• Image 3: Human MCF7
  
  Host: Rabbit
  Target Name: LAS1L
  Sample Type: MCF7
  Antibody Dilution: 1.0ug/mlLAS1L is supported by BioGPS gene expression data to be expressed in MCF7
• Image 4: Human Hela
  
  Host: Rabbit
  Target Name: LAS1L
  Sample Type: Hela
  Antibody Dilution: 1.0ug/mlLAS1L is supported by BioGPS gene expression data to be expressed in HeLa
• Image 5: Human HT1080
  
  Host: Rabbit
  Target Name: LAS1L
  Sample Type: HT1080
  Antibody Dilution: 1.0ug/mlLAS1L is supported by BioGPS gene expression data to be expressed in HT1080
• Image 6: Human OVCAR-3
  
  Host: Rabbit
  Target Name: LAS1L
  Sample Type: OVCAR-3
  Antibody Dilution: 1.0ug/mlLAS1L is supported by BioGPS gene expression data to be expressed in OVCAR3