BTBD14A Antibody - N-terminal region (ARP34627_T100)

• Product Number: ARP34627_T100
• Name: BTBD14A Antibody - N-terminal region (ARP34627_T100)
• Protein Size (# AA): 587 amino acids
• Molecular Weight: 63kDa
• NCBI Gene Id: 138151
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: NACC family member 2, BEN and BTB (POZ) domain containing
• Alias Symbols: RBB, BEND9, NAC-2, BTBD14, BTBD31, BTBD14A
• Peptide Sequence: Synthetic peptide located within the following region: CDVSIVVKGQAFKAHRAVLAASSLYFRDLFSGNSKSAFELPGSVPPACFQ
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: cDNA sequence was generated by The National Institutes of Health Mammalian Gene Collection (MGC) Program.
• Protein Interactions: RBBP7; NACC2; MTA3; MTA2; MTA1; RBBP4; HDAC2; HDAC1; CHD4; EPS8; UBC;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-NACC2 (ARP34627_T100) antibody is Catalog # AAP34627 (Previous Catalog # AAPS07407)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human BTBD14A
• Uniprot ID: Q96BF6
• Protein Name: Nucleus accumbens-associated protein 2
• Protein Accession #: NP_653254
• Purification: Protein A purified
• Nucleotide Accession #: NM_144653
• Tested Species Reactivity: Human
• Gene Symbol: NACC2
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
• Image 1: Human Jurkat
  
  WB Suggested Anti-BTBD14A Antibody Titration: 0.625ug/ml
  Positive Control: Jurkat cell lysate
• Image 2: Human kidney
  
  Human kidney