KCNIP4 Antibody - N-terminal region (ARP34622_T100)

Data Sheet
 
Product Number ARP34622_T100
Product Page www.avivasysbio.com/kcnip4-antibody-n-terminal-region-arp34622-t100.html
Name KCNIP4 Antibody - N-terminal region (ARP34622_T100)
Protein Size (# AA) 250 amino acids
Molecular Weight 29kDa
NCBI Gene Id 80333
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Kv channel interacting protein 4
Alias Symbols CALP, KCHIP4
Peptide Sequence Synthetic peptide located within the following region: NSTKRSIKERLMKLLPCSAAKTSSPAIQNSVEDELEMATVRHRPEALELL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Pruunsild,P., et al., (2005) Genomics 86 (5), 581-593
Description of Target KVNIP4 is a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belong to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. This protein member also interacts with presenilin. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene.
Protein Interactions APP; KCND2; PSEN2; PSEN1; KCNIP2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-KCNIP4 (ARP34622_T100) antibody
Blocking Peptide For anti-KCNIP4 (ARP34622_T100) antibody is Catalog # AAP34622
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human KCNIP4
Uniprot ID Q6PIL6
Protein Name Kv channel-interacting protein 4
Protein Accession # NP_079497
Purification Protein A purified
Nucleotide Accession # NM_025221
Tested Species Reactivity Human
Gene Symbol KCNIP4
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human Jurkat
WB Suggested Anti-KCNIP4 Antibody
Titration: 1.25 ug/ml
Positive Control: Jurkat Whole Cell
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com