Product Number |
ARP34622_T100 |
Product Page |
www.avivasysbio.com/kcnip4-antibody-n-terminal-region-arp34622-t100.html |
Name |
KCNIP4 Antibody - N-terminal region (ARP34622_T100) |
Protein Size (# AA) |
250 amino acids |
Molecular Weight |
29kDa |
NCBI Gene Id |
80333 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Kv channel interacting protein 4 |
Alias Symbols |
CALP, KCHIP4 |
Peptide Sequence |
Synthetic peptide located within the following region: NSTKRSIKERLMKLLPCSAAKTSSPAIQNSVEDELEMATVRHRPEALELL |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Pruunsild,P., et al., (2005) Genomics 86 (5), 581-593 |
Description of Target |
KVNIP4 is a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belong to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. This protein member also interacts with presenilin. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. |
Protein Interactions |
APP; KCND2; PSEN2; PSEN1; KCNIP2; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-KCNIP4 (ARP34622_T100) antibody |
Blocking Peptide |
For anti-KCNIP4 (ARP34622_T100) antibody is Catalog # AAP34622 |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human KCNIP4 |
Uniprot ID |
Q6PIL6 |
Protein Name |
Kv channel-interacting protein 4 |
Protein Accession # |
NP_079497 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_025221 |
Tested Species Reactivity |
Human |
Gene Symbol |
KCNIP4 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
Image 1 | Human Jurkat
| WB Suggested Anti-KCNIP4 Antibody Titration: 1.25 ug/ml Positive Control: Jurkat Whole Cell |
|
|