Product Number |
ARP34622_P050 |
Product Page |
www.avivasysbio.com/kcnip4-antibody-n-terminal-region-arp34622-p050.html |
Name |
KCNIP4 Antibody - N-terminal region (ARP34622_P050) |
Protein Size (# AA) |
250 amino acids |
Molecular Weight |
29kDa |
NCBI Gene Id |
80333 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Kv channel interacting protein 4 |
Alias Symbols |
CALP, KCHIP4 |
Peptide Sequence |
Synthetic peptide located within the following region: NSTKRSIKERLMKLLPCSAAKTSSPAIQNSVEDELEMATVRHRPEALELL |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Morohashi,Y., et al., (2002) J. Biol. Chem. 277 (17), 14965-14975 |
Description of Target |
KCNIP4 encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belong to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. This protein member also interacts with presenilin. |
Protein Interactions |
APP; KCND2; PSEN2; PSEN1; KCNIP2; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-KCNIP4 (ARP34622_P050) antibody |
Blocking Peptide |
For anti-KCNIP4 (ARP34622_P050) antibody is Catalog # AAP34622 (Previous Catalog # AAPP05812) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human KCNIP4 |
Uniprot ID |
Q6PIL6 |
Protein Name |
Kv channel-interacting protein 4 |
Protein Accession # |
NP_079497 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_025221 |
Tested Species Reactivity |
Human |
Gene Symbol |
KCNIP4 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Rabbit |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
Image 1 | Human Jurkat
| WB Suggested Anti-KCNIP4 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Jurkat cell lysate |
| Image 2 | Human Brain
| Human Brain |
|
|