| Product Number |
ARP34618_T100 |
| Product Page |
www.avivasysbio.com/rin3-antibody-n-terminal-region-arp34618-t100.html |
| Name |
RIN3 Antibody - N-terminal region (ARP34618_T100) |
| Protein Size (# AA) |
985 amino acids |
| Molecular Weight |
108kDa |
| NCBI Gene Id |
79890 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Ras and Rab interactor 3 |
| Peptide Sequence |
Synthetic peptide located within the following region: AGMFLVRRDSSSKQLVLCVHFPSLNESSAEVLEYTIKEEKSILYLEGSAL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Kajiho,H., et al., (2003) J. Cell. Sci. 116 (Pt 20), 4159-4168 |
| Description of Target |
RIN3, biochemically characterized as the stimulator and stabilizer for GTP-Rab5, plays an important role in the transport pathway from plasma membrane to early endosomes. |
| Protein Interactions |
MYC; TNFAIP1; RABAC1; RGS2; RAB5C; BIN1; RAB5B; RAB5A; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-RIN3 (ARP34618_T100) antibody |
| Blocking Peptide |
For anti-RIN3 (ARP34618_T100) antibody is Catalog # AAP34618 (Previous Catalog # AAPP05808) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human RIN3 |
| Uniprot ID |
Q76LB3 |
| Protein Name |
Ras and Rab interactor 3 |
| Sample Type Confirmation |
There is BioGPS gene expression data showing that RIN3 is expressed in HepG2 |
| Protein Accession # |
NP_079108 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_024832 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
RIN3 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 77%; Horse: 92%; Human: 100%; Mouse: 79%; Pig: 93%; Rat: 90% |
| Image 1 | Human HepG2
 | WB Suggested Anti-RIN3 Antibody Titration: 5.0ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysateThere is BioGPS gene expression data showing that RIN3 is expressed in HepG2 |
|
|
