C16ORF44 Antibody - N-terminal region (ARP34616_T100)

• Product Number: ARP34616_T100
• Name: C16ORF44 Antibody - N-terminal region (ARP34616_T100)
• Protein Size (# AA): 616 amino acids
• Molecular Weight: 70kDa
• NCBI Gene Id: 79786
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Kelch-like 36 (Drosophila)
• Alias Symbols: C16orf44
• Peptide Sequence: Synthetic peptide located within the following region: FCCEYLEQEVSEDNYLYLQELASIYSLKRLDAFIDGFILNHFGTLSFTPD
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Ota,T., et al., (2004) Nat. Genet. 36 (1), 40-45
• Description of Target: C16orf44 is an open reading frame 44, found in chromosome 16
• Protein Interactions: HSP90AA1; COPS5; CUL3; UBC;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-KLHL36 (ARP34616_T100) antibody is Catalog # AAP34616 (Previous Catalog # AAPP05806)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C16ORF44
• Uniprot ID: Q8N4N3
• Protein Name: Kelch-like protein 36
• Protein Accession #: NP_079007
• Purification: Protein A purified
• Nucleotide Accession #: NM_024731
• Tested Species Reactivity: Human
• Gene Symbol: KLHL36
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 83%
• Image 1: Human HepG2
  
  WB Suggested Anti-C16ORF44 Antibody Titration: 1.0ug/ml
  ELISA Titer: 1:500
  Positive Control: HepG2 cell lysate