KLHL25 Antibody - N-terminal region (ARP34609_T100)

Data Sheet
 
Product Number ARP34609_T100
Product Page www.avivasysbio.com/klhl25-antibody-n-terminal-region-arp34609-t100.html
Name KLHL25 Antibody - N-terminal region (ARP34609_T100)
Protein Size (# AA) 589 amino acids
Molecular Weight 66kDa
NCBI Gene Id 64410
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Kelch-like 25 (Drosophila)
Alias Symbols ENC2, ENC-2
Peptide Sequence Synthetic peptide located within the following region: RLYEFSWRMCLVHFETVRQSEDFNSLSKDTLLDLISSDELETEDERVVFE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Kimura,K., (2006) Genome Res. 16 (1), 55-65
Description of Target KLHL25 is also known as ENC2. It is a BTB/POZ KELCH domain protein
Protein Interactions UBC; HSP90AA1; CUL3; EIF4EBP1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-KLHL25 (ARP34609_T100) antibody
Blocking Peptide For anti-KLHL25 (ARP34609_T100) antibody is Catalog # AAP34609 (Previous Catalog # AAPP23617)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human KLHL25
Uniprot ID Q9H0H3
Protein Name Ectoderm-neural cortex protein 2
Protein Accession # NP_071925
Purification Protein A purified
Nucleotide Accession # NM_022480
Tested Species Reactivity Human
Gene Symbol KLHL25
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Pig, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 100%; Guinea Pig: 93%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 86%; Rat: 86%
Image 1
Human Jurkat
WB Suggested Anti-KLHL25 Antibody Titration: 0.3125ug/ml
Positive Control: Jurkat cell lysate
Image 2
Human Brain
Human Brain
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com