DMTF1 antibody - C-terminal region (ARP34602_P050)
Data Sheet
Product Number ARP34602_P050
Product Page
Product Name DMTF1 antibody - C-terminal region (ARP34602_P050)
Size 100 ul
Gene Symbol DMTF1
Alias Symbols DMP1, DMTF, FLJ41265, hDMP1
Protein Size (# AA) 494 amino acids
Molecular Weight 54kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 9988
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Cyclin D binding myb-like transcription factor 1
Description This is a rabbit polyclonal antibody against DMTF1. It was validated on Western Blot and immunohistochemistry by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (
Peptide Sequence Synthetic peptide located within the following region: SFNDAHVSKFSDQNSTELMNSVMVRTEEEISDTDLKQEESPSDLASAYVT
Description of Target DMTF1 binds specifically to the nonamer DNA consensus sequences CCCG(G/T)ATGT to activate transcription.
Protein Interactions SRA1; TP53; ATF7IP; CCND1; CCND3; CCND2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-DMTF1 (ARP34602_P050) antibody is Catalog # AAP34602 (Previous Catalog # AAPP23615)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human DMTF1
Complete computational species homology data Anti-DMTF1 (ARP34602_P050)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express DMTF1.
Swissprot Id Q9Y222
Protein Name Cyclin-D-binding Myb-like transcription factor 1

Yang, KC; Kitamura, Y; Wu, CC; Chang, HH; Ling, TY; Kuo, TF; Tooth Germ-Like Construct Transplantation for Whole-Tooth Regeneration: An In Vivo Study in the Miniature Pig. 40, E39-50 (2016). IHC, WB, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 26582651

Protein Accession # EAW76962
Purification Affinity Purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express DMTF1.
Nucleotide Accession # NM_001142326
Replacement Item This antibody may replace item sc-38068 from Santa Cruz Biotechnology.
Conjugation Options

ARP34602_P050-FITC Conjugated

ARP34602_P050-HRP Conjugated

ARP34602_P050-Biotin Conjugated

CB Replacement sc-38068; sc-38069; sc-6551; sc-6552; sc-81249
Species Reactivity Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Dog: 92%; Guinea Pig: 91%; Horse: 92%; Human: 100%; Mouse: 92%; Rabbit: 92%; Rat: 92%
Image 1
Human Intestine
Human Intestine
Image 2
Human HepG2
WB Suggested Anti-DMTF1 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 |