| Product Number |
ARP34600_P050 |
| Product Page |
http://www.avivasysbio.com/anti-cbx8-antibody-middle-region-arp34600-p050.html |
| Product Name |
CBX8 antibody - middle region (ARP34600_P050) |
| Size |
50ug |
| Gene Symbol |
CBX8 |
| Nucleotide Accession# |
NM_020649 |
| Protein Accession# |
NP_065700 |
| Protein Size (# AA) |
389 amino acids |
| Molecular Weight |
43kDa |
| Product Format |
Lyophilized powder |
| Purification |
Affinity Purified |
| Clonality |
Polyclonal |
| Official Gene Full Name |
Chromobox homolog 8 |
| Swissprot Id |
Q9HC52 |
| Alias Symbols |
PC3; RC1 |
| NCBI Gene Id |
57332 |
| Host |
Rabbit |
| Description |
This is a rabbit polyclonal antibody against CBX8. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (info@avivasysbio.com). |
| Peptide Sequence |
Synthetic peptide located within the following region: QCGVTSPSSAEATGKLAVDTFPARVIKHRAAFLEAKGQGALDPNGTRVRH |
| Key Reference |
Bardos,J.I., et al., (2000) J. Biol. Chem. 275 (37), 28785-28792 |
| Description of Target |
CBX8 is one of the proteins homolog to the Polycomb group (PcG) proteins. They assemble to form large multiprotein complexes involved in gene silencing. Evidence suggests that PcG complexes are heterogeneous with respect to both protein composition and specific function. |
| Partner Proteins |
ATF7IP, CCND1, CCND2, CCND3 |
| Reconstitution and Storage |
Add 50 μl of distilled water. Final anti-CBX8 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead Time |
Domestic: within 24 hours delivery
International: 3-5 business days |
| Blocking Peptide |
For anti-CBX8 antibody is Catalog # AAP34600 (Previous Catalog # AAPP05782) |
| Immunogen |
The immunogen for anti-CBX8 antibody: synthetic peptide directed towards the middle region of human CBX8 |
| Complete computational species homology data |
CBX8 antibody - middle region (ARP34600_P050) |
| Tissue Tool |
Find tissues and cell lines supported to express CBX8.  |
| Storage Buffer |
After reconstitution buffer contains 2% sucrose, PBS, and 0.1% sodium azide. |
| Reviews and Data |
Computational species homology for CBX8 antibody (ARP34600); Product Protocols: CBX8 antibody tested with Human Hepg2 Cells (ARP34600_P050) |
| Observed Species Reactivity |
Human, Mouse, Rat, Dog, Bovine |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100%; Bovine: 92%; Dog: 92%; Pig: 92%; Rabbit: 92%; Mouse: 85%; Rat: 85% |
| Image 1 | Human HepG2
 | WB Suggested Anti-CBX8 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate |
|
