| Product Number |
ARP34589_P050 |
| Product Page |
www.avivasysbio.com/wdr45l-antibody-n-terminal-region-arp34589-p050.html |
| Name |
Wdr45l Antibody - N-terminal region (ARP34589_P050) |
| Protein Size (# AA) |
344 amino acids |
| Molecular Weight |
37kDa |
| NCBI Gene Id |
360682 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Wdr45 like |
| Alias Symbols |
WIPI-3, Wdr45l, RGD1305141 |
| Peptide Sequence |
Synthetic peptide located within the following region: YLALVGGGKKPKYPPNKVMIWDDLKKKTVIEIEFSTEVKAVKLRRDRIVV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of this protein remains unknown. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Wdr45b (ARP34589_P050) antibody |
| Blocking Peptide |
For anti-Wdr45b (ARP34589_P050) antibody is Catalog # AAP34589 (Previous Catalog # AAPP23614) |
| Uniprot ID |
Q2MCP5 |
| Protein Name |
Protein Wdr45l Ensembl ENSRNOP00000051801 |
| Protein Accession # |
NP_001034676 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001039587 |
| Tested Species Reactivity |
Rat |
| Gene Symbol |
Wdr45b |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
| Image 1 | Rat Liver
 | WB Suggested Anti-Wdr45l Antibody
Titration: 1.0 ug/ml
Positive Control: Rat Liver |
|
|
