| Product Number |
ARP34570_T100 |
| Product Page |
www.avivasysbio.com/btbd5-antibody-middle-region-arp34570-t100.html |
| Name |
BTBD5 Antibody - middle region (ARP34570_T100) |
| Protein Size (# AA) |
571 amino acids |
| Molecular Weight |
64kDa |
| NCBI Gene Id |
54813 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Kelch-like 28 (Drosophila) |
| Alias Symbols |
BTBD5 |
| Peptide Sequence |
Synthetic peptide located within the following region: GVVVLAGELYALGGYDGQSYLQSVEKYIPKIRKWQPVAPMTTTRSCFAAA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Strausberg,R.L., et al., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 |
| Description of Target |
BTBD5 is a transcription factor containing BTB (POZ) domain |
| Protein Interactions |
CUL3; UBC; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-KLHL28 (ARP34570_T100) antibody |
| Blocking Peptide |
For anti-KLHL28 (ARP34570_T100) antibody is Catalog # AAP34570 (Previous Catalog # AAPP05752) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human BTBD5 |
| Uniprot ID |
Q9NXS3 |
| Protein Name |
Kelch-like protein 28 |
| Protein Accession # |
NP_060128 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_017658 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
KLHL28 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93% |
| Image 1 | Human HepG2
 | WB Suggested Anti-BTBD5 Antibody Titration: 1.0ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysate |
|
|
