KMT5B Antibody - middle region (ARP34567_P050)

• Product Number: ARP34567_P050
• Name: KMT5B Antibody - middle region (ARP34567_P050)
• Protein Size (# AA): 885 amino acids
• Molecular Weight: 99 kDa
• NCBI Gene Id: 51111
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: lysine methyltransferase 5B
• Alias Symbols: CGI85, MRD51, CGI-85, SUV420H1
• Peptide Sequence: Synthetic peptide located within the following region: NNGFNSGSGSSSTKLKIQLKRDEENRGSYTEGLHENGVCCSDPLSLLESR
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Twells,R.C., et al., (2001) Genomics 72 (3), 231-241
• Description of Target: This gene encodes a protein that contains a SET domain. SET domains appear to be protein-protein interaction domains that mediate interactions with a family of proteins that display similarity with dual-specificity phosphatases (dsPTPases). The function of this gene has not been determined. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene.
• Protein Interactions: SMARCD1; HIST1H4A; YWHAQ;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation: SPR Affinity Characterization
  
• Blocking Peptide: For anti-KMT5B (ARP34567_P050) antibody is Catalog # AAP34567 (Previous Catalog # AAPP05749)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SUV420H1
• Uniprot ID: Q4FZB7
• Protein Name: histone-lysine N-methyltransferase KMT5B
• Publications:

  Gatta, R. & Mantovani, R. NF-Y substitutes H2A-H2B on active cell-cycle promoters: recruitment of CoREST-KDM1 and fine-tuning of H3 methylations. Nucleic Acids Res. 36, 6592-607 (2008). 18940868

  Murata, T. et al. Epigenetic histone modification of Epstein-Barr virus BZLF1 promoter during latency and reactivation in Raji cells. J. Virol. 86, 4752-61 (2012). 22357272

• Purification: Affinity Purified
• Tested Species Reactivity: Human
• Gene Symbol: KMT5B
• Predicted Species Reactivity: Human, Mouse, Rat, Dog, Guinea Pig, Horse
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Dog: 86%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 91%; Rat: 93%
• Image 1: Human Skin
  
  Rabbit Anti-SUV420H1 Antibody
  Catalog Number: ARP34567
  Paraffin Embedded Tissue: Human Skin
  Cellular Data: Squamous epithelial cells
  Antibody Concentration: 4.0-8.0 ug/ml
  Magnification: 400X
• Image 2: Human Fetal Lung
  
  Host: Rabbit
  Target Name: NSUN6
  Sample Type: Human Fetal Lung
  Antibody Dilution: 1.0ug/ml
• Image 3: Human Fetal Liver
  
  Host: Rabbit
  Target Name: FAM46C
  Sample Type: Human Fetal Liver
  Antibody Dilution: 1.0ug/ml
• Image 4: Human Placenta
  
  WB Suggested Anti-SUV420H1 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:1562500
  Positive Control: Human Placenta
• Image 5:
  
  Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.