| Product Number |
ARP34560_P050 |
| Product Page |
www.avivasysbio.com/per3-antibody-n-terminal-region-arp34560-p050.html |
| Name |
PER3 Antibody - N-terminal region (ARP34560_P050) |
| Protein Size (# AA) |
1201 amino acids |
| Molecular Weight |
132kDa |
| NCBI Gene Id |
8863 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Period homolog 3 (Drosophila) |
| Alias Symbols |
GIG13, FASPS3 |
| Peptide Sequence |
Synthetic peptide located within the following region: GAPQADVSMYSLEELATIASEHTSKNTDTFVAVFSFLSGRLVHISEQAAL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Johansson,C., et al., (2003) Neuropsychopharmacology 28 (4), 734-739 |
| Description of Target |
PER3 is a member of the Period family of genes and is expressed in a circadian pattern in the suprachiasmatic nucleus, the primary circadian pacemaker in the mammalian brain. Genes in this family encode components of the circadian rhythms of locomotor activity, metabolism, and behavior. Circadian expression in the suprachiasmatic nucleus continues in constant darkness, and a shift in the light/dark cycle evokes a proportional shift of gene expression in the suprachiasmatic nucleus. The specific function of this gene is not yet known. |
| Protein Interactions |
CHEK2; ATM; Csnk1e; CRY1; CRY2; PER2; ARNTL; PER1; CLOCK; CSNK1D; SP1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-PER3 (ARP34560_P050) antibody |
| Blocking Peptide |
For anti-PER3 (ARP34560_P050) antibody is Catalog # AAP34560 (Previous Catalog # AAPP05742) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human PER3 |
| Uniprot ID |
Q8TAR6 |
| Protein Name |
PER3 protein EMBL AAH26102.1 |
| Protein Accession # |
NP_058515 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_016831 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
PER3 |
| Predicted Species Reactivity |
Human, Rat, Dog, Horse, Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Dog: 79%; Horse: 93%; Human: 100%; Pig: 92%; Rat: 79% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-PER3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Jurkat cell lysate |
|
|
