Rnf141 Antibody - N-terminal region (ARP34555_P050)

Data Sheet
 
Product Number ARP34555_P050
Product Page www.avivasysbio.com/rnf141-antibody-n-terminal-region-arp34555-p050.html
Name Rnf141 Antibody - N-terminal region (ARP34555_P050)
Protein Size (# AA) 230 amino acids
Molecular Weight 25kDa
NCBI Gene Id 67150
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Ring finger protein 141
Alias Symbols ZFP3, ZFP36, ZNF23, ZNF230, AA792898, AU022812, 2610110L04Rik
Peptide Sequence Synthetic peptide located within the following region: SDQTQLVINKLPEKVAKHVTLVRESGSLTYEEFLGRVAELNDVTAKVAAG
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target Rnf141 may be involved in spermatogenesis.
Protein Interactions Map3k1; SMURF1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-Rnf141 (ARP34555_P050) antibody
Blocking Peptide For anti-Rnf141 (ARP34555_P050) antibody is Catalog # AAP34555 (Previous Catalog # AAPP05737)
Uniprot ID Q99MB7
Protein Name RING finger protein 141
Protein Accession # NP_080275
Purification Affinity Purified
Nucleotide Accession # NM_025999
Tested Species Reactivity Mouse
Gene Symbol Rnf141
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Image 1
Mouse Kidney
WB Suggested Anti-Rnf141 Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Kidney
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com