Product Number |
ARP34555_P050 |
Product Page |
www.avivasysbio.com/rnf141-antibody-n-terminal-region-arp34555-p050.html |
Name |
Rnf141 Antibody - N-terminal region (ARP34555_P050) |
Protein Size (# AA) |
230 amino acids |
Molecular Weight |
25kDa |
NCBI Gene Id |
67150 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Ring finger protein 141 |
Alias Symbols |
ZFP3, ZFP36, ZNF23, ZNF230, AA792898, AU022812, 2610110L04Rik |
Peptide Sequence |
Synthetic peptide located within the following region: SDQTQLVINKLPEKVAKHVTLVRESGSLTYEEFLGRVAELNDVTAKVAAG |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
Rnf141 may be involved in spermatogenesis. |
Protein Interactions |
Map3k1; SMURF1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-Rnf141 (ARP34555_P050) antibody |
Blocking Peptide |
For anti-Rnf141 (ARP34555_P050) antibody is Catalog # AAP34555 (Previous Catalog # AAPP05737) |
Uniprot ID |
Q99MB7 |
Protein Name |
RING finger protein 141 |
Protein Accession # |
NP_080275 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_025999 |
Tested Species Reactivity |
Mouse |
Gene Symbol |
Rnf141 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100% |
Image 1 | Mouse Kidney
| WB Suggested Anti-Rnf141 Antibody Titration: 1.0 ug/ml Positive Control: Mouse Kidney |
|
|