| Product Number |
ARP34554_P050 |
| Product Page |
www.avivasysbio.com/rnf141-antibody-middle-region-arp34554-p050.html |
| Name |
RNF141 Antibody - middle region (ARP34554_P050) |
| Protein Size (# AA) |
230 amino acids |
| Molecular Weight |
26kDa |
| NCBI Gene Id |
50862 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Ring finger protein 141 |
| Alias Symbols |
ZFP26, RFP141, ZNF230 |
| Peptide Sequence |
Synthetic peptide located within the following region: RIMNLYQFIQLYKDITSQAAGVLAQSSTSEEPDENSSSVTSCQASLWMGR |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Qiu,W., et al., (2003) Biochem. Biophys. Res. Commun. 306 (2), 347-353 |
| Description of Target |
The protein encoded by RNF141 contains a RING finger, a motif known to be involved in protein-DNA and protein-protein interactions. Abundant expression of this gene was found in the testicular tissue of fertile men, but was not detected in azoospermic patients. Studies of the mouse counterpart suggest that this gene may function as a testis specific transcription factor during spermatogenesis. |
| Protein Interactions |
TRIM8; TRIM24; DTX3; ELAVL1; SMURF1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-RNF141 (ARP34554_P050) antibody |
| Blocking Peptide |
For anti-RNF141 (ARP34554_P050) antibody is Catalog # AAP34554 (Previous Catalog # AAPP05736) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human RNF141 |
| Uniprot ID |
Q8WVD5 |
| Protein Name |
RING finger protein 141 |
| Publications |
Liu, Y. et al. A new mutant transcript generated in Znf230 exon 2 knockout mice reveals a potential exon structure in the targeting vector sequence. Acta Biochim. Biophys. Sin. (Shanghai). 45, 123-8 (2013). 23196134 |
| Protein Accession # |
NP_057506 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_016422 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
RNF141 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 93%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 85%; Rat: 93% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-RNF141 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate |
| | Image 2 | Human Brain
 | Human Brain |
| | Image 3 | Human kidney
 | Human kidney |
|
|
