RTRAF Antibody - N-terminal region (ARP34545_P050)

Data Sheet
 
Product Number ARP34545_P050
Product Page www.avivasysbio.com/rtraf-antibody-n-terminal-region-arp34545-p050.html
Name RTRAF Antibody - N-terminal region (ARP34545_P050)
Protein Size (# AA) 244 amino acids
Molecular Weight 28kDa
NCBI Gene Id 51637
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name RNA transcription, translation and transport factor
Alias Symbols CLE, CLE7, hCLE, CGI99, RLLM1, hCLE1, CGI-99, LCRP369, C14orf166
Peptide Sequence Synthetic peptide located within the following region: GLAVRLEYGDNAEKYKDLVPDNSKTADNATKNAEPLINLDVNNPDFKAGV
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Howng,S.L., et al., (2004) FEBS Lett. 566 (1-3), 162-168
Protein Interactions FUS; FAM98A; HUWE1; UBC; RPA3; RPA2; RPA1; BMI1; rev; KRT18; ILF2; HNRNPU; FLII; FKBP3; DHX9; DDX1; ABCF1; RTCB; RPL26L1; IGF2BP3; SYNCRIP; LRRFIP1; EIF2B2; EIF2B3; YBX3; RFC4; RFC2; PRKDC; NMT1; MRE11A; GLP1R; BAG3; FN1; DAB2; NOTCH1; FAM98B; C2orf49; MC
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-RTRAF (ARP34545_P050) antibody
Blocking Peptide For anti-RTRAF (ARP34545_P050) antibody is Catalog # AAP34545 (Previous Catalog # AAPP05727)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human C14orf166
Uniprot ID Q9Y224
Protein Name RNA transcription, translation and transport factor protein
Sample Type Confirmation

C14orf166 is supported by BioGPS gene expression data to be expressed in Jurkat

Protein Accession # NP_057123
Purification Affinity Purified
Nucleotide Accession # NM_016039
Tested Species Reactivity Human
Gene Symbol RTRAF
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 92%; Guinea Pig: 85%; Horse: 92%; Human: 100%; Mouse: 92%; Pig: 92%; Rabbit: 92%; Rat: 85%
Image 1
Human Bronchial Epithelial Tissue
Rabbit Anti-C14orf166 Antibody
Catalog Number: ARP34545_P050
Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue
Observed Staining: Cytoplasmic
Primary Antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec
Image 2
Human Jurkat
WB Suggested Anti-C14orf166 Antibody Titration: 0.125ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysateC14orf166 is supported by BioGPS gene expression data to be expressed in Jurkat
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com