| Product Number |
ARP34537_P050 |
| Product Page |
www.avivasysbio.com/klhl25-antibody-n-terminal-region-arp34537-p050.html |
| Name |
KLHL25 Antibody - N-terminal region (ARP34537_P050) |
| Protein Size (# AA) |
589 amino acids |
| Molecular Weight |
66kDa |
| NCBI Gene Id |
64410 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Kelch-like 25 (Drosophila) |
| Alias Symbols |
ENC2, ENC-2 |
| Peptide Sequence |
Synthetic peptide located within the following region: SRYFEAMFSHGLRESRDDTVNFQDNLHPEVLELLLDFAYSSRIAINEENA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Kimura,K., et al., (2006) Genome Res. 16 (1), 55-65 |
| Description of Target |
KLHL25 is also known as ENC2. It is a BTB/POZ KELCH domain protein |
| Protein Interactions |
UBC; HSP90AA1; CUL3; EIF4EBP1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-KLHL25 (ARP34537_P050) antibody |
| Blocking Peptide |
For anti-KLHL25 (ARP34537_P050) antibody is Catalog # AAP34537 (Previous Catalog # AAPP06009) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human KLHL25 |
| Uniprot ID |
Q9H0H3 |
| Protein Name |
Ectoderm-neural cortex protein 2 |
| Sample Type Confirmation |
KLHL25 is supported by BioGPS gene expression data to be expressed in HepG2 |
| Protein Accession # |
NP_071925 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_022480 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
KLHL25 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 92%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 100% |
| Image 1 | Human HepG2
 | WB Suggested Anti-KLHL25 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysateKLHL25 is supported by BioGPS gene expression data to be expressed in HepG2 |
|
| Image 2 | Human Kidney
 | Rabbit Anti-KLHL25 antibody
Catalog Number: ARP34537
Formalin Fixed Paraffin Embedded Tissue: Human Kidney
Primary antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20x
Exposure Time: 0.5-2.0sec
|
|
