FHL2 Antibody - C-terminal region (ARP34506_T100)

Data Sheet
 
Product Number ARP34506_T100
Product Page www.avivasysbio.com/fhl2-antibody-c-terminal-region-arp34506-t100.html
Name FHL2 Antibody - C-terminal region (ARP34506_T100)
Protein Size (# AA) 279 amino acids
Molecular Weight 32kDa
NCBI Gene Id 2274
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Four and a half LIM domains 2
Alias Symbols DRAL, AAG11, FHL-2, SLIM3, SLIM-3
Peptide Sequence Synthetic peptide located within the following region: RFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDC
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Lee,S.W., et al., (2006) Biochem. Biophys. Res. Commun. 339 (4), 1056-1062
Description of Target FHL2 is a member of LIM proteins that contain a highly conserved double zinc finger motif called the LIM domain.
Protein Interactions SP2; RFX3; REL; NRF1; JUP; INCA1; FAM154A; ZNF417; FAM129A; GLYR1; CCDC92; ARHGAP9; KIAA1217; GNG12; DCP1A; ZFP64; BANP; KANK2; RAI2; ZMYM4; BLZF1; ZNF131; CSN2; SIGLEC6; DTX2; TRIM63; TRIM55; FOXO1; SUMO2; PTCH1; DCTN3; HEXIM1; ERP44; SMAD4; SMAD3; SMAD2
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-FHL2 (ARP34506_T100) antibody
Blocking Peptide For anti-FHL2 (ARP34506_T100) antibody is Catalog # AAP34506 (Previous Catalog # AAPY00528)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human FHL2
Uniprot ID Q14192
Protein Name Four and a half LIM domains protein 2
Publications

Han, W. et al. FHL2 interacts with and acts as a functional repressor of Id2 in human neuroblastoma cells. Nucleic Acids Res. 37, 3996-4009 (2009). 19417068

Saeki, Y. et al. Ligand-specific sequential regulation of transcription factors for differentiation of MCF-7 cells. BMC Genomics 10, 545 (2009). 19925682

Protein Accession # NP_963849
Purification Protein A purified
Nucleotide Accession # NM_201555
Tested Species Reactivity Human
Gene Symbol FHL2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 87%
Image 1
Human Heart
Human Heart
Image 2
Human heart
WB Suggested Anti-FHL2 Antibody Titration: 0.6ug/ml
ELISA Titer: 1:312500
Positive Control: Human heart
Image 3
Human Fetal Heart , Human Brain
Host: Rabbit
Target: FHL2
Positive control (+): Human Fetal Heart (HE)
Negative control (-): Human Brain (BR)
Antibody concentration: 2.5ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com