| Product Number |
ARP34503_P050 |
| Product Page |
www.avivasysbio.com/onecut3-antibody-c-terminal-region-arp34503-p050.html |
| Name |
ONECUT3 Antibody - C-terminal region (ARP34503_P050) |
| Protein Size (# AA) |
372 amino acids |
| Molecular Weight |
41kDa |
| NCBI Gene Id |
390874 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
One cut homeobox 3 |
| Alias Symbols |
OC3 |
| Peptide Sequence |
Synthetic peptide located within the following region: VTISQQLGLELNTVSNFFMNARRRCMNRWAEEPSTAPGGPAGATATFSKA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
LOC390874 is a new protein with unknown function |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ONECUT3 (ARP34503_P050) antibody |
| Blocking Peptide |
For anti-ONECUT3 (ARP34503_P050) antibody is Catalog # AAP34503 (Previous Catalog # AAPY00525) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human LOC390874 |
| Uniprot ID |
O60422 |
| Protein Accession # |
XP_372702 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
XM_372702 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ONECUT3 |
| Predicted Species Reactivity |
Human, Cow, Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Human: 100%; Pig: 93% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-ONECUT3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Jurkat cell lysate |
|
|
