| Product Number |
ARP34498_P050 |
| Product Page |
www.avivasysbio.com/vax1-antibody-n-terminal-region-arp34498-p050.html |
| Name |
Vax1 Antibody - N-terminal region (ARP34498_P050) |
| Protein Size (# AA) |
186 amino acids |
| Molecular Weight |
21kDa |
| NCBI Gene Id |
11023 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Ventral anterior homeobox 1 |
| Alias Symbols |
MCOPS11 |
| Peptide Sequence |
Synthetic peptide located within the following region: MFGKPDKMDVRCHSDAEAARVSKNAHKESRESKGAEGNLPAAFLKEPQGA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Holland,P.W., (er) BMC Biol. 5, 47 (2007) |
| Description of Target |
VAX1 is a homeo-domain containing protein from a class of homeobox transcription factors which are conserved in vertebrates. It may play an important role in the development of anterior ventral forebrain and visual system.This gene encodes a homeo-domain containing protein from a class of homeobox transcription factors which are conserved in vertebrates. Genes of this family are involved in the regulation of body development and morphogenesis. The most conserved genes, called HOX genes are found in special gene clusters. This gene belongs to the VAX subfamily and lies in the vicinity of the EMX homeobox gene family. Another member of VAX family is located on chromosome 2. The encoded protein may play an important role in the development of anterior ventral forebrain and visual system. Multiple transcript variants encoding different isoforms have been found for this gene. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-180 AK127095.1 1-180 181-201 AL731557.7 35785-35805 c 202-1186 AK127095.1 199-1183 1187-4494 AL731557.7 26205-29512 c |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Vax1 (ARP34498_P050) antibody |
| Blocking Peptide |
For anti-Vax1 (ARP34498_P050) antibody is Catalog # AAP34498 (Previous Catalog # AAPP23522) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human Vax1 |
| Uniprot ID |
B1AVW5 |
| Protein Name |
Ventral anterior homeobox 1 |
| Protein Accession # |
NP_954582 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_199131 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
Vax1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-Vax1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate |
|
|
