| Product Number |
ARP34485_T100 |
| Product Page |
www.avivasysbio.com/znf498-antibody-middle-region-arp34485-t100.html |
| Name |
ZNF498 Antibody - middle region (ARP34485_T100) |
| Protein Size (# AA) |
310 amino acids |
| Molecular Weight |
35kDa |
| NCBI Gene Id |
221785 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Zinc finger protein 498 |
| Alias Symbols |
ZNF498 |
| Peptide Sequence |
Synthetic peptide located within the following region: QIDCFGEYVEPQDCRVSPGGGSKEKEAKPPQEDLKGALVALTSERFGEAS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Laity,J.H., (2001) Curr. Opin. Struct. Biol. 11 (1), 39-46 |
| Description of Target |
The function of ZNF498 remains unknown. The protein bears some similarity to zinc finger proteins, which are involved in DNA binding and protein-protein interactions. Alternative splicing results in two transcript variants encoding different proteins. Additional splice variants have been identified, but their biological validity has not been determinedThis gene encodes a protein of unknown function. The protein bears some similarity to zinc finger proteins, which are involved in DNA binding and protein-protein interactions. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZSCAN25 (ARP34485_T100) antibody |
| Blocking Peptide |
For anti-ZSCAN25 (ARP34485_T100) antibody is Catalog # AAP34485 (Previous Catalog # AAPY00507) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human ZNF498 |
| Uniprot ID |
Q14C99 |
| Protein Name |
Zinc finger protein 498 |
| Protein Accession # |
NP_660090 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_145115 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZSCAN25 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100%; Mouse: 93%; Rabbit: 86%; Rat: 93% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-ZNF498 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate |
| | Image 2 | Human Intestine
 | Human Intestine |
|
|
