BTBD1 Antibody - N-terminal region (ARP34479_P050)

• Product Number: ARP34479_P050
• Name: BTBD1 Antibody - N-terminal region (ARP34479_P050)
• Protein Size (# AA): 482 amino acids
• Molecular Weight: 53kDa
• NCBI Gene Id: 53339
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: BTB (POZ) domain containing 1
• Alias Symbols: C15orf1, NS5ATP8
• Peptide Sequence: Synthetic peptide located within the following region: LPLQREPLYNWQATKASLKERFAFLFNSELLSDVRFVLGKGRGAAAAGGP
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Mehrle,A., Nucleic Acids Res. 34 (DATABASE ISSUE), D415-D418 (2006)
• Description of Target: The C-terminus of BTBD1 binds topoisomerase I. The N-terminus contains a proline-rich region and a BTB/POZ domain (broad-complex, Tramtrack and bric a brac/Pox virus and Zinc finger), both of which are typically involved in protein-protein interactions. Subcellularly, the protein localizes to cytoplasmic bodies.The C-terminus of the protein encoded by this gene binds topoisomerase I. The N-terminus contains a proline-rich region and a BTB/POZ domain (broad-complex, Tramtrack and bric a brac/Pox virus and Zinc finger), both of which are typically involved in protein-protein interactions. Subcellularly, the protein localizes to cytoplasmic bodies. Alternative splicing results in multiple transcript variants encoding different isoforms.
• Protein Interactions: CUL3; LRR1; FMOD; NEDD8; COPS4; COPS5; COPS3; UBC; TOP1; COPS6; CUL5; SUMO1; TRIM5;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-BTBD1 (ARP34479_P050) antibody is Catalog # AAP34479 (Previous Catalog # AAPP23518)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human BTBD1
• Uniprot ID: Q9H0C5
• Protein Name: BTB/POZ domain-containing protein 1
• Sample Type Confirmation:

  BTBD1 is supported by BioGPS gene expression data to be expressed in 721_B

• Protein Accession #: NP_079514
• Purification: Affinity Purified
• Nucleotide Accession #: NM_025238
• Tested Species Reactivity: Human
• Gene Symbol: BTBD1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Guinea Pig
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%
• Image 1: Human Adult Placenta
  
  Host: Rabbit
  Target Name: BTBD1
  Sample Type: Human Adult Placenta
  Antibody Dilution: 1.0ug/ml
• Image 2: Human Fetal Lung
  
  Host: Rabbit
  Target Name: BTBD1
  Sample Type: Human Fetal Lung
  Antibody Dilution: 1.0ug/ml
• Image 3: Human Fetal Heart
  
  Host: Rabbit
  Target Name: BTBD1
  Sample Type: Human Fetal Heart
  Antibody Dilution: 1.0ug/ml
• Image 4: Human 721_B
  
  WB Suggested Anti-BTBD1 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: 721_B cell lysateBTBD1 is supported by BioGPS gene expression data to be expressed in 721_B