ZNF655 Antibody - N-terminal region (ARP34473_P050)

Data Sheet
 
Product Number ARP34473_P050
Product Page www.avivasysbio.com/znf655-antibody-n-terminal-region-arp34473-p050.html
Name ZNF655 Antibody - N-terminal region (ARP34473_P050)
Protein Size (# AA) 181 amino acids
Molecular Weight 20kDa
NCBI Gene Id 79027
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Zinc finger protein 655
Alias Symbols VIK, VIK-1
Peptide Sequence Synthetic peptide located within the following region: QVPALPREGSPGDQAAALLTARYQEFVTFEDVAVHLTREEWGYLDPVQRD
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target ZNF655 is a zinc finger protein. The zinc finger proteins are involved in DNA binding and protein-protein interactions.
Protein Interactions MAGEA2B; SPERT; KRT40; CARD9; RINT1; MED21; TRAF2; KIFC3; BAG3; HTT; KRTAP4-12; MTUS2; ASUN; TRIM37; TRIP13; MAGEA11; VAV1; CDK4;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ZNF655 (ARP34473_P050) antibody
Blocking Peptide For anti-ZNF655 (ARP34473_P050) antibody is Catalog # AAP34473 (Previous Catalog # AAPY00435)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF655
Uniprot ID D6W5T4
Protein Name Zinc finger protein 655
Protein Accession # NP_076966
Purification Affinity Purified
Nucleotide Accession # NM_024061
Tested Species Reactivity Human
Gene Symbol ZNF655
Predicted Species Reactivity Human, Mouse, Rat, Cow, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 91%
Image 1
Human COLO205
WB Suggested Anti-ZNF655 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: COLO205 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com