ZA20D3 Antibody - middle region (ARP34464_T100)

Data Sheet
 
Product Number ARP34464_T100
Product Page www.avivasysbio.com/za20d3-antibody-middle-region-arp34464-t100.html
Name ZA20D3 Antibody - middle region (ARP34464_T100)
Protein Size (# AA) 208 amino acids
Molecular Weight 23kDa
NCBI Gene Id 54469
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Zinc finger, AN1-type domain 6
Alias Symbols AWP1, ZA20D3, ZFAND5B
Peptide Sequence Synthetic peptide located within the following region: SDTAQQPSEEQSKSLEKPKQKKNRCFMCRKKVGLTGFECRCGNVYCGVHR
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Duan,W., et al., (2000) Gene 256 (1-2), 113-121
Description of Target ZA20D3 is a zinc-finger protein located on chromosome 15.
Protein Interactions TRAF5; PPP2R1A; UBC; TRAF2; WIPI2; USP3; CDC34; DNM2; PKN1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ZFAND6 (ARP34464_T100) antibody
Blocking Peptide For anti-ZFAND6 (ARP34464_T100) antibody is Catalog # AAP34464 (Previous Catalog # AAPY00426)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ZA20D3
Uniprot ID Q6FIF0
Protein Name AN1-type zinc finger protein 6
Sample Type Confirmation

ZFAND6 is supported by BioGPS gene expression data to be expressed in Jurkat

Protein Accession # NP_061879
Purification Protein A purified
Nucleotide Accession # NM_019006
Tested Species Reactivity Human
Gene Symbol ZFAND6
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
Image 1
Human kidney
Human kidney
Image 2
Human Jurkat
WB Suggested Anti-ZA20D3 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysateZFAND6 is supported by BioGPS gene expression data to be expressed in Jurkat
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com