RRN3 Antibody - C-terminal region (ARP34462_P050)

Data Sheet
 
Product Number ARP34462_P050
Product Page www.avivasysbio.com/rrn3-antibody-c-terminal-region-arp34462-p050.html
Name RRN3 Antibody - C-terminal region (ARP34462_P050)
Protein Size (# AA) 650 amino acids
Molecular Weight 74kDa
NCBI Gene Id 54700
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name RRN3 RNA polymerase I transcription factor homolog (S. cerevisiae)
Alias Symbols TIFIA, A-270G1.2
Peptide Sequence Synthetic peptide located within the following region: KKDIVEDEDDDFLKGEVPQNDTVIGITPSSFDTHFRSPSSSVGSPPVLYM
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Miller,G., et al., (2001) EMBO J. 20 (6), 1373-1382
Description of Target RRN3 is RNA polymerase I-specific transcription initiation factor. Phosphorylation of RRN3 by MAPK cascades links cell signaling with the control of gene expression, namely results in rRNA synthesis in turn cell growth..
Protein Interactions UBC; ACTA1; Polr1e; POLR1B; EIF3L; NMI; RBM15; UBD; Trim28; ELAVL1; TAF1D; POLR1A; MYO1C; TAF1C; TAF1B; TAF1A; UBTF; TBP; PPP2R2A; CDK2; CCNE1; RIBIN; ACTB;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-RRN3 (ARP34462_P050) antibody
Blocking Peptide For anti-RRN3 (ARP34462_P050) antibody is Catalog # AAP34462 (Previous Catalog # AAPY00424)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human RRN3
Uniprot ID Q9NYV6
Protein Name RNA polymerase I-specific transcription initiation factor RRN3
Sample Type Confirmation

RRN3 is supported by BioGPS gene expression data to be expressed in Jurkat

Protein Accession # NP_060897
Purification Affinity Purified
Nucleotide Accession # NM_018427
Tested Species Reactivity Human
Gene Symbol RRN3
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 79%; Dog: 86%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 86%; Rabbit: 86%; Rat: 86%; Yeast: 100%
Image 1
Human Jurkat
WB Suggested Anti-RRN3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysateRRN3 is supported by BioGPS gene expression data to be expressed in Jurkat
Image 2
Human PANC1 Whole Cell
Host: Rabbit
Target Name: RRN3
Sample Tissue: Human PANC1 Whole Cell
Antibody Dilution: 0.5ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com