| Product Number |
ARP34450_T100 |
| Product Page |
www.avivasysbio.com/ybx2-antibody-middle-region-arp34450-t100.html |
| Name |
YBX2 Antibody - middle region (ARP34450_T100) |
| Protein Size (# AA) |
364 amino acids |
| Molecular Weight |
39kDa |
| NCBI Gene Id |
51087 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Y box binding protein 2 |
| Alias Symbols |
DBPC, MSY2, CSDA3, CONTRIN |
| Peptide Sequence |
Synthetic peptide located within the following region: RKSRRFIPRPPSVAPPPMVAEIPSAGTGPGSKGERAEDSGQRPRRWCPPP |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Tekur,S., et al., (1999) J. Androl. 20 (1), 135-144 |
| Description of Target |
YBX2 is a member of the Y box multigene family of proteins; it contains the cold shock domain that is highly conserved among all Y box proteins and four basic/aromatic islands. By Northern blotting and immunoblotting, MSY2 appears to be a germ cell-specific protein in the testis. In the ovary, MSY2 is present exclusively in diplotene-stage and mature oocytes. MSY2 is maternally inherited in the one-cell-stage embryo but is not detected in the late two-cell-stage embryo. This loss of MSY2 is coincident with the bulk degradation of maternal mRNAs in the two-cell embryo. |
| Protein Interactions |
IGSF8; HDAC11; ICAM1; UBC; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-YBX2 (ARP34450_T100) antibody |
| Blocking Peptide |
For anti-YBX2 (ARP34450_T100) antibody is Catalog # AAP34450 (Previous Catalog # AAPY00412) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human YBX2 |
| Uniprot ID |
Q9Y2T7 |
| Protein Name |
Y-box-binding protein 2 |
| Protein Accession # |
NP_057066 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_015982 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
YBX2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 86%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 86%; Rabbit: 86%; Rat: 86% |
| Image 1 | Human kidney
 | Human kidney |
| | Image 2 | Human HepG2
 | WB Suggested Anti-YBX2 Antibody Titration: 1.0ug/ml
ELISA Titer: 1:12500
Positive Control: HepG2 cell lysate |
|
|
