WDR39 Antibody - C-terminal region (ARP34399_T100)

Data Sheet
 
Product Number ARP34399_T100
Product Page www.avivasysbio.com/wdr39-antibody-c-terminal-region-arp34399-t100.html
Name WDR39 Antibody - C-terminal region (ARP34399_T100)
Protein Size (# AA) 339 amino acids
Molecular Weight 38kDa
NCBI Gene Id 9391
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Cytosolic iron-sulfur protein assembly 1
Alias Symbols CIA1, WDR39
Peptide Sequence Synthetic peptide located within the following region: LSGFHSRTIYDIAWCQLTGALATACGDDAIRVFQEDPNSDPQQPTFSLTA
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Johnstone,R.W., (1998) J. Biol. Chem. 273 (18), 10880-10887
Description of Target WDR39 is a member of the WD40 family of proteins. WDR39 specifically interacts with WT1 both in vitro and in vivo. This interaction results in a decrease in transcriptional activation mediated by WT1. WDR39 does not inhibit binding of WT1 to its consensus nucleotide sequence and does not affect the repression activity of WT1. Thus, WDR39 appears to specifically modulate the transactivation activity of WT1 and may function to regulate the physiological functions of WT1 in cell growth and differentiation.
Protein Interactions FAM96B; SF1; MEOX1; FAM96A; MMS19; FMNL2; TOE1; DPP9; FMNL3; CTU1; PPIL4; MAK16; WDR75; NSRP1; EEPD1; WDR61; CDC73; UPF3B; NARFL; YAE1D1; TYW1; ELP2; ELP3; UCKL1; CDKAL1; DPP8; ELP6; PAF1; PLEKHA5; PHAX; RTEL1; ELP4; POLA2; ELP5; WDR43; ERP29; GLRX3; CTR9
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CIAO1 (ARP34399_T100) antibody
Blocking Peptide For anti-CIAO1 (ARP34399_T100) antibody is Catalog # AAP34399 (Previous Catalog # AAPP23689)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human WDR39
Uniprot ID O76071
Protein Name Probable cytosolic iron-sulfur protein assembly protein CIAO1
Sample Type Confirmation

CIAO1 is supported by BioGPS gene expression data to be expressed in Jurkat

Protein Accession # NP_004795
Purification Protein A purified
Nucleotide Accession # NM_004804
Tested Species Reactivity Human
Gene Symbol CIAO1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 86%; Horse: 86%; Human: 100%; Mouse: 86%; Pig: 86%; Rabbit: 86%; Rat: 86%
Image 1
Human Jurkat
WB Suggested Anti-WDR39 Antibody Titration: 2.5ug/ml
Positive Control: Jurkat cell lysateCIAO1 is supported by BioGPS gene expression data to be expressed in Jurkat
Image 2
Human Heart
Rabbit Anti-WDR39 antibody
Catalog Number: ARP34399
Paraffin Embedded Tissue: Human Heart
cell Cellular Data: cardiac cell
Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com