POU2F2 Antibody - N-terminal region (ARP34383_T100)

Data Sheet
 
Product Number ARP34383_T100
Product Page www.avivasysbio.com/pou2f2-antibody-n-terminal-region-arp34383-t100.html
Name POU2F2 Antibody - N-terminal region (ARP34383_T100)
Protein Size (# AA) 463 amino acids
Molecular Weight 49kDa
NCBI Gene Id 5452
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name POU class 2 homeobox 2
Alias Symbols OCT2, OTF2, Oct-2
Peptide Sequence Synthetic peptide located within the following region: SPSEHTDTERNGPDTNHQNPQNKTSPFSVSPTGPSTKIKAEDPSGDSAPA
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Sepulveda,M.A., et al., (2004) J. Immunol. 172 (2), 1054-1064
Description of Target POU2F2 is a member of the POU family and is predominantly expressed in B cells, in activated T cells, and in the nervous system.
Protein Interactions TLE4; UBC; HMGA1; MNAT1; POU2AF1; TBP; POU2F2; HMGB2; XRCC6; NR3C1; TXNRD1; RXRA; PGR; ESR1; AR; GAPDH;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-POU2F2 (ARP34383_T100) antibody
Blocking Peptide For anti-POU2F2 (ARP34383_T100) antibody is Catalog # AAP34383 (Previous Catalog # AAPY00225)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human POU2F2
Uniprot ID P09086-4
Protein Name POU domain, class 2, transcription factor 2
Sample Type Confirmation

POU2F2 is supported by BioGPS gene expression data to be expressed in HepG2

Protein Accession # NP_002689
Purification Protein A purified
Nucleotide Accession # NM_002698
Tested Species Reactivity Human
Gene Symbol POU2F2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 79%; Rat: 100%
Image 1
Human HepG2
WB Suggested Anti-POU2F2 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysatePOU2F2 is supported by BioGPS gene expression data to be expressed in HepG2
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com