| Product Number |
ARP34362_T100 |
| Product Page |
www.avivasysbio.com/colq-antibody-n-terminal-region-arp34362-t100.html |
| Name |
COLQ Antibody - N-terminal region (ARP34362_T100) |
| Protein Size (# AA) |
455 amino acids |
| Molecular Weight |
48kDa |
| NCBI Gene Id |
8292 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Collagen-like tail subunit (single strand of homotrimer) of asymmetric acetylcholinesterase |
| Alias Symbols |
EAD, CMS5 |
| Peptide Sequence |
Synthetic peptide located within the following region: LQLFFLSIVSQPTFINSVLPISAALPSLDQKKRGGHKACCLLTPPPPPLF |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Ting,A.K., et al., (2005) Chem. Biol. Interact. 157-158, 63-70 |
| Description of Target |
COLQ encodes the subunit of a collagen-like molecule associated with acetylcholinesterase in skeletal muscle. Each molecule is composed of three identical subunits. Each subunit contains a proline-rich attachment domain (PRAD) that binds an acetylcholinesterase tetramer to anchor the catalytic subunit of the enzyme to the basal lamina. Mutations in COLQ are associated with endplate acetylcholinesterase deficiency. |
| Protein Interactions |
UBC; MUSK; BCHE; ACHE; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-COLQ (ARP34362_T100) antibody |
| Blocking Peptide |
For anti-COLQ (ARP34362_T100) antibody is Catalog # AAP34362 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human COLQ |
| Uniprot ID |
Q6DK18 |
| Protein Name |
Acetylcholinesterase collagenic tail peptide |
| Protein Accession # |
NP_005668 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_005677 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
COLQ |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Horse: 93%; Human: 100%; Mouse: 92%; Rabbit: 93%; Rat: 93% |
| Image 1 | Human HepG2
 | WB Suggested Anti-COLQ Antibody
Titration: 1.25 ug/ml
Positive Control: HepG2 Whole Cell |
|
|
