MGC4618 Antibody - N-terminal region (ARP34360_P050)

• Product Number: ARP34360_P050
• Name: MGC4618 Antibody - N-terminal region (ARP34360_P050)
• Protein Size (# AA): 504 amino acids
• Molecular Weight: 56 kDa
• NCBI Gene Id: 84286
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Transmembrane protein 175
• Alias Symbols: hTMEM175
• Peptide Sequence: Synthetic peptide located within the following region: QRMLSFSDALLSIIATVMILPVTHTEISPEQQFDRSVQRLLATRIAVYLM
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Strausberg,R.L., et al., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903
• Description of Target: The MGC4618 is a hypothetical protein found in Chromosome 4.
• Protein Interactions: APP;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Blocking Peptide: For anti-TMEM175 (ARP34360_P050) antibody is Catalog # AAP34360 (Previous Catalog # AAPY00135)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MGC4618
• Uniprot ID: Q9BSA9
• Protein Name: Transmembrane protein 175
• Protein Accession #: NP_115702
• Purification: Affinity Purified
• Nucleotide Accession #: NM_032326
• Tested Species Reactivity: Human
• Gene Symbol: TMEM175
• Predicted Species Reactivity: Human, Mouse, Rat, Dog, Guinea Pig, Horse
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Dog: 100%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Rat: 100%
• Image 1: Human HepG2
  
  WB Suggested Anti-MGC4618 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:1562500
  Positive Control: HepG2 cell lysate