MANSC1 Antibody - N-terminal region (ARP34359_T100)

Data Sheet
 
Product Number ARP34359_T100
Product Page www.avivasysbio.com/mansc1-antibody-n-terminal-region-arp34359-t100.html
Name MANSC1 Antibody - N-terminal region (ARP34359_T100)
Protein Size (# AA) 431 amino acids
Molecular Weight 47kDa
NCBI Gene Id 54682
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name MANSC domain containing 1
Alias Symbols LOH12CR3, 9130403P13Rik
Peptide Sequence Synthetic peptide located within the following region: LTLRLSASQNCLKKSLEDVVIDIQSSLSKGIRGNEPVYTSTQEDCINSCC
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Clark,H.F., (2003) Genome Res. 13 (10), 2265-2270
Description of Target MANSC1, located on chromosome 12, encodes a protein whose function is not yet defined.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-MANSC1 (ARP34359_T100) antibody
Blocking Peptide For anti-MANSC1 (ARP34359_T100) antibody is Catalog # AAP34359
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human MANSC1
Uniprot ID Q9H8J5
Protein Name MANSC domain-containing protein 1
Protein Accession # NP_060520
Purification Protein A purified
Nucleotide Accession # NM_018050
Tested Species Reactivity Human
Gene Symbol MANSC1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Horse, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 83%; Dog: 90%; Horse: 92%; Human: 100%; Mouse: 90%; Rabbit: 79%; Rat: 90%
Image 1
Human Fetal Kidney
WB Suggested Anti-MANSC1 Antibody Titration: 5.0ug/ml
Positive Control: Fetal kidney lysate
Image 2
Human Lung
Human Lung
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com