Product Number |
ARP34359_P050 |
Product Page |
www.avivasysbio.com/mansc1-antibody-n-terminal-region-arp34359-p050.html |
Name |
MANSC1 Antibody - N-terminal region (ARP34359_P050) |
Protein Size (# AA) |
431 amino acids |
Molecular Weight |
47kDa |
NCBI Gene Id |
54682 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
MANSC domain containing 1 |
Alias Symbols |
LOH12CR3, 9130403P13Rik |
Peptide Sequence |
Synthetic peptide located within the following region: LTLRLSASQNCLKKSLEDVVIDIQSSLSKGIRGNEPVYTSTQEDCINSCC |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Clark,H.F., et al., (2003) Genome Res. 13 (10), 2265-2270 |
Description of Target |
MANSC1, located on chromosome 12, encodes a protein whose function is not yet defined. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-MANSC1 (ARP34359_P050) antibody |
Blocking Peptide |
For anti-MANSC1 (ARP34359_P050) antibody is Catalog # AAP34359 (Previous Catalog # AAPY00134) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human MANSC1 |
Uniprot ID |
Q9H8J5 |
Protein Name |
MANSC domain-containing protein 1 |
Protein Accession # |
NP_060520 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_018050 |
Tested Species Reactivity |
Human |
Gene Symbol |
MANSC1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Rabbit |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 83%; Dog: 90%; Horse: 92%; Human: 100%; Mouse: 90%; Rabbit: 79%; Rat: 90% |
Image 1 | Human Muscle
| Human Muscle |
| Image 2 | Human kidney
| WB Suggested Anti-MANSC1 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Human kidney |
|
|