MANSC1 Antibody - N-terminal region (ARP34359_P050)

Data Sheet
 
Product Number ARP34359_P050
Product Page www.avivasysbio.com/mansc1-antibody-n-terminal-region-arp34359-p050.html
Name MANSC1 Antibody - N-terminal region (ARP34359_P050)
Protein Size (# AA) 431 amino acids
Molecular Weight 47kDa
NCBI Gene Id 54682
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name MANSC domain containing 1
Alias Symbols LOH12CR3, 9130403P13Rik
Peptide Sequence Synthetic peptide located within the following region: LTLRLSASQNCLKKSLEDVVIDIQSSLSKGIRGNEPVYTSTQEDCINSCC
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Clark,H.F., et al., (2003) Genome Res. 13 (10), 2265-2270
Description of Target MANSC1, located on chromosome 12, encodes a protein whose function is not yet defined.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-MANSC1 (ARP34359_P050) antibody
Blocking Peptide For anti-MANSC1 (ARP34359_P050) antibody is Catalog # AAP34359 (Previous Catalog # AAPY00134)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human MANSC1
Uniprot ID Q9H8J5
Protein Name MANSC domain-containing protein 1
Protein Accession # NP_060520
Purification Affinity Purified
Nucleotide Accession # NM_018050
Tested Species Reactivity Human
Gene Symbol MANSC1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Horse, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 83%; Dog: 90%; Horse: 92%; Human: 100%; Mouse: 90%; Rabbit: 79%; Rat: 90%
Image 1
Human Muscle
Human Muscle
Image 2
Human kidney
WB Suggested Anti-MANSC1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human kidney
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com