Product Number |
ARP34354_P050 |
Product Page |
www.avivasysbio.com/zfpl1-antibody-middle-region-arp34354-p050.html |
Name |
ZFPL1 Antibody - middle region (ARP34354_P050) |
Protein Size (# AA) |
310 amino acids |
Molecular Weight |
34kDa |
NCBI Gene Id |
7542 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Zinc finger protein-like 1 |
Alias Symbols |
MCG4, D11S750 |
Peptide Sequence |
Synthetic peptide located within the following region: NGPIFPPTNLAGPVASALREKLATVNWARAGLGLPLIDEVVSPEPEPLNT |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Hoppener,J.W., et al., () Genomics 50 (2), 251-259 1998 |
Description of Target |
ZFPL1 is expressed strongly in the exocrine pancreas as a 1.4-kb polyadenylated RNA encoding a putative protein of 310 amino acids. |
Protein Interactions |
UBC; ATP5J2; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ZFPL1 (ARP34354_P050) antibody |
Blocking Peptide |
For anti-ZFPL1 (ARP34354_P050) antibody is Catalog # AAP34354 (Previous Catalog # AAPY00129) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human ZFPL1 |
Uniprot ID |
O95159 |
Protein Name |
Zinc finger protein-like 1 |
Protein Accession # |
NP_006773 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_006782 |
Tested Species Reactivity |
Human |
Gene Symbol |
ZFPL1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 92%; Goat: 100%; Guinea Pig: 100%; Horse: 92%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
Image 1 | Human kidney
| Human kidney |
| Image 2 | Human Muscle
| WB Suggested Anti-ZFPL1 Antibody Titration: 0.2-1 ug/ml Positive Control: Human Muscle |
|
|