| Product Number |
ARP34337_P050 |
| Product Page |
www.avivasysbio.com/zbtb40-antibody-n-terminal-region-arp34337-p050.html |
| Name |
ZBTB40 Antibody - N-terminal region (ARP34337_P050) |
| Protein Size (# AA) |
1239 amino acids |
| Molecular Weight |
138kDa |
| NCBI Gene Id |
9923 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Zinc finger and BTB domain containing 40 |
| Alias Symbols |
ZNF923 |
| Peptide Sequence |
Synthetic peptide located within the following region: CSVQGQVVRDVSAPSSETFRKEPEKPQVEILSSEGAGEPHSSPELAATPG |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
ZBTB40 may be involved in transcriptional regulation. |
| Protein Interactions |
Dlg4; SUMO2; UBC; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZBTB40 (ARP34337_P050) antibody |
| Blocking Peptide |
For anti-ZBTB40 (ARP34337_P050) antibody is Catalog # AAP34337 (Previous Catalog # AAPP05687) |
| Uniprot ID |
Q9NUA8 |
| Protein Name |
Zinc finger and BTB domain-containing protein 40 |
| Sample Type Confirmation |
ZBTB40 is strongly supported by BioGPS gene expression data to be expressed in HeLa |
| Protein Accession # |
NP_055685 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_014870 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZBTB40 |
| Predicted Species Reactivity |
Human, Rat, Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100%; Pig: 79%; Rat: 79% |
| Image 1 | Human HeLa
 | WB Suggested Anti-ZBTB40 Antibody
Titration: 1.0 ug/ml
Positive Control: Hela Whole CellZBTB40 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells |
|
|
