RNF10 Antibody - N-terminal region (ARP34336_P050)

• Product Number: ARP34336_P050
• Name: RNF10 Antibody - N-terminal region (ARP34336_P050)
• Protein Size (# AA): 811 amino acids
• Molecular Weight: 90kDa
• NCBI Gene Id: 9921
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Ring finger protein 10
• Alias Symbols: RIE2
• Peptide Sequence: Synthetic peptide located within the following region: PPRSASAGPAGESKPKSDGKNSSGSKRYNRKRELSYPKNESFNNQSRRSS
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Stelzl,U., (2005) Cell 122 (6), 957-968
• Description of Target: RNF10 contains a ring finger motif, which is known to be involved in protein-protein interactions. The specific function of this protein has not yet been determined. EST data suggests the existence of multiple alternatively spliced transcript variants, however, their full length nature is not known. The protein encoded by this gene contains a ring finger motif, which is known to be involved in protein-protein interactions. The specific function of this protein has not yet been determined. EST data suggests the existence of multiple alternatively spliced transcript variants, however, their full length nature is not known.
• Protein Interactions: KDM1A; UBTD1; TARDBP; UBC; HSP90AA1; UL49; TRIM26; MEOX2; MDM2; TERF1; GRB2; UBE2U; UBE2J2; UBE2O; UBE2W; UBE2D4; UBE2E3; UBE2V1; UBE2I; UBE2H; UBE2E2; UBE2E1; UBE2D3; UBE2D2; UBE2D1; SNCA; LRIF1; CCDC90B; SETDB1; UTP14A; TLE1; COL4A5; EEF1A1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-RNF10 (ARP34336_P050) antibody is Catalog # AAP34336 (Previous Catalog # AAPP05686)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RNF10
• Uniprot ID: Q8N5U6
• Protein Name: RING finger protein 10
• Sample Type Confirmation:

  RNF10 is strongly supported by BioGPS gene expression data to be expressed in HeLa

• Protein Accession #: NP_055683
• Purification: Affinity Purified
• Nucleotide Accession #: NM_014868
• Tested Species Reactivity: Human
• Gene Symbol: RNF10
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
• Image 1: Human HeLa
  
  WB Suggested Anti-RNF10 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:500
  Positive Control: Hela cell lysateRNF10 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells