website statistics
Product Datasheet: ARP34318_T100 - CNOT3 antibody - N-terminal region (ARP34318_T100) - Aviva Systems Biology
CNOT3 antibody - N-terminal region (ARP34318_T100)
Data Sheet
Product Number ARP34318_T100
Product Page
Product Name CNOT3 antibody - N-terminal region (ARP34318_T100)
Size 100 ul
Gene Symbol CNOT3
Alias Symbols NOT3, LENG2, NOT3H
Protein Size (# AA) 609 amino acids
Molecular Weight 67kDa
Subunit 3
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 4849
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name CCR4-NOT transcription complex, subunit 3
Description This is a rabbit polyclonal antibody against CNOT3. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (
Peptide Sequence Synthetic peptide located within the following region: QFESEVESLSVQTRKKKGDKDKQDRIEGLKRHIEKHRYHVRMLETILRML
Target Reference Albert,T.K., et al., (2000) Nucleic Acids Res. 28 (3), 809-817
Description of Target CNOT3 is a protein component of CCR4-NOT protein complex. Yeast CCR$-NOT is a global regulator of RNA polymerase II transcription. It is comprised of yeast NOT1 to NOT5, yeast CCR4 and additional proteins like yeast CAF1.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-CNOT3 (ARP34318_T100) antibody is Catalog # AAP34318
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human CNOT3
Complete computational species homology data Anti-CNOT3 (ARP34318_T100)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express CNOT3.
Swissprot Id O75175-2
Protein Name CCR4-NOT transcription complex subunit 3
Sample Type Confirmation

CNOT3 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

Protein Accession # AAF29828
Purification Protein A purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express CNOT3.
Nucleotide Accession # NM_014516
Replacement Item This antibody may replace item sc-133471 from Santa Cruz Biotechnology.
Conjugation Options

ARP34318_T100-FITC Conjugated

ARP34318_T100-HRP Conjugated

ARP34318_T100-Biotin Conjugated

CB Replacement sc-133471; sc-72939; sc-81230; sc-82824
Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Image 1
Human Jurkat
WB Suggested Anti-CNOT3 Antibody
Titration: 1.25 ug/ml
Positive Control: Jurkat Whole Cell

CNOT3 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 |