SAP30BP Antibody - N-terminal region (ARP34304_P050)

Data Sheet
 
Product Number ARP34304_P050
Product Page www.avivasysbio.com/sap30bp-antibody-n-terminal-region-arp34304-p050.html
Name SAP30BP Antibody - N-terminal region (ARP34304_P050)
Protein Size (# AA) 308 amino acids
Molecular Weight 34kDa
NCBI Gene Id 29115
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name SAP30 binding protein
Alias Symbols HTRG, HTRP, HCNGP
Peptide Sequence Synthetic peptide located within the following region: AEEKGGLVSDAYGEDDFSRLGGDEDGYEEEEDENSRQSEDDDSETEKPEA
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Li,J.F., et al., (2004) J. Biochem. 136 (2), 169-176
Description of Target SAP30BP is a component of a histone deacetylase complex conserved among eukaryotic organisms. This complex is active in deacetylating core histone octamers, but inactive in deacetylating nucleosomal histones due to the inability of the histone binding proteins RbAp46 and RbAp48 to gain access to nucleosomal histones.
Protein Interactions THAP1; TFIP11; PUF60; HUWE1; UBC; GOLGA2; FHL3; LMNA; CSNK2A2; FRA10AC1; RBM17; WDR83; WDR77; U2AF2; THOC1; RBM39; DHX8; CSNK2A1; ZNF408; ZNF212; MLX; FHL2; TAF15; SNCA; HSPD1; FUS; FLNC; EWSR1; DYNC1H1; DDX1; DDB1; DCTN1; SF3A2; SUMO2; RPS6KA6; GSK3B; TE
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-SAP30BP (ARP34304_P050) antibody
Blocking Peptide For anti-SAP30BP (ARP34304_P050) antibody is Catalog # AAP34304 (Previous Catalog # AAPP05654)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human SAP30BP
Uniprot ID Q9UHR5
Protein Name SAP30-binding protein
Protein Accession # NP_037392
Purification Affinity Purified
Nucleotide Accession # NM_013260
Tested Species Reactivity Human
Gene Symbol SAP30BP
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human Heart
Rabbit Anti-SAP30BP antibody
Catalog Number: ARP34304_P050
Paraffin Embedded Tissue: Human Heart cell
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
Image 2
Human Placenta
WB Suggested Anti-SAP30BP Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Placenta
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com