SAP30BP Antibody - C-terminal region (ARP34303_P050)

Data Sheet
 
Product Number ARP34303_P050
Product Page www.avivasysbio.com/sap30bp-antibody-c-terminal-region-arp34303-p050.html
Name SAP30BP Antibody - C-terminal region (ARP34303_P050)
Protein Size (# AA) 308 amino acids
Molecular Weight 34kDa
NCBI Gene Id 29115
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name SAP30 binding protein
Alias Symbols HTRG, HTRP, HCNGP
Peptide Sequence Synthetic peptide located within the following region: WSEDSYYEALAKAQKIEMDKLEKAKKERTKIEFVTGTKKGTTTNATSTTT
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Li,J.F., et al., (2004) J. Biochem. 136 (2), 169-176
Description of Target SAP30BP expressed as a fusion polypeptide with a fluorescent protein in the nucleus of HeLa cells. SAP30BP induces cell death. The interaction of SAP30BP with SAP30 in its conserved domain implies that this protein family, as the products of immediate-early genes, comprise functional molecules involved in the transcriptional regulation of cells, which might be related to the inhibition of some cell survival genes. SAP30BP may also be involved in the regulation of beta-2-microglobulin genes.
Protein Interactions THAP1; TFIP11; PUF60; HUWE1; UBC; GOLGA2; FHL3; LMNA; CSNK2A2; FRA10AC1; RBM17; WDR83; WDR77; U2AF2; THOC1; RBM39; DHX8; CSNK2A1; ZNF408; ZNF212; MLX; FHL2; TAF15; SNCA; HSPD1; FUS; FLNC; EWSR1; DYNC1H1; DDX1; DDB1; DCTN1; SF3A2; SUMO2; RPS6KA6; GSK3B; TE
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-SAP30BP (ARP34303_P050) antibody
Blocking Peptide For anti-SAP30BP (ARP34303_P050) antibody is Catalog # AAP34303 (Previous Catalog # AAPP05653)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human SAP30BP
Uniprot ID Q9UHR5
Protein Name SAP30-binding protein
Sample Type Confirmation

SAP30BP is supported by BioGPS gene expression data to be expressed in MCF7

Protein Accession # NP_037392
Purification Affinity Purified
Nucleotide Accession # NM_013260
Tested Species Reactivity Human
Gene Symbol SAP30BP
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Image 1
Human MCF-7
WB Suggested Anti-SAP30BP Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: MCF7 cell lysateSAP30BP is supported by BioGPS gene expression data to be expressed in MCF7
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com