CFAP20 Antibody - C-terminal region (ARP34301_P050)

• Product Number: ARP34301_P050
• Name: CFAP20 Antibody - C-terminal region (ARP34301_P050)
• Protein Size (# AA): 193 amino acids
• Molecular Weight: 23kDa
• NCBI Gene Id: 29105
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: cilia and flagella associated protein 20
• Alias Symbols: GTL3, BUG22, EVORF, fSAP23, C16orf80
• Peptide Sequence: Synthetic peptide located within the following region: YGTNYIETLRVQIHANCRIRRVYFSDRLYSEDELPAEFKLYLPVQNKAKQ
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Rijkers,T. et al., (1996) Biochim. Biophys. Acta 1307 (3), 294-300
• Protein Interactions: BMI1; TFCP2L1; UBC; SF3A2; YWHAG;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-CFAP20 (ARP34301_P050) antibody is Catalog # AAP34301 (Previous Catalog # AAPP05651)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human GTL3
• Uniprot ID: Q9Y6A4
• Protein Name: cilia- and flagella-associated protein 20
• Protein Accession #: NP_037374
• Purification: Affinity Purified
• Nucleotide Accession #: NM_013242
• Tested Species Reactivity: Human
• Gene Symbol: CFAP20
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Goat: 77%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Image 1: Human Placenta
  
  WB Suggested Anti-GTL3 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:62500
  Positive Control: Human Placenta