Product Number |
ARP34275_T100 |
Product Page |
www.avivasysbio.com/arid3b-antibody-n-terminal-region-arp34275-t100.html |
Name |
ARID3B Antibody - N-terminal region (ARP34275_T100) |
Protein Size (# AA) |
560 amino acids |
Molecular Weight |
61kDa |
NCBI Gene Id |
10620 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
AT rich interactive domain 3B (BRIGHT-like) |
Alias Symbols |
BDP, DRIL2 |
Peptide Sequence |
Synthetic peptide located within the following region: DPRVAPMSNLLPAPGLPPHGQQAKEDHTKDASKASPSVSTAGQPNWNLDE |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Kortschak,R.D., (2000) Trends Biochem. Sci. 25 (6), 294-299 |
Description of Target |
ARID3B is a member of the ARID (AT-rich interaction domain) family of DNA-binding proteins. The protein is homologous with two proteins that bind to the retinoblastoma gene product, and also with the mouse Bright and Drosophila dead ringer proteins. Members of the ARID family have roles in embryonic patterning, cell lineage gene regulation, cell cycle control, transcriptional regulation and possibly in chromatin structure modification. This gene is a member of the ARID (AT-rich interaction domain) family of proteins which bind DNA. It is homologous with two proteins that bind to the retinoblastoma gene product and also with the mouse Bright and Drosophila dead ringer proteins. A pseudogene on chromosome 1p31 also exists for this gene. Other ARID family members have roles in embryonic patterning, cell lineage gene regulation, cell cycle control, transcriptional regulation and possibly in chromatin structure modification. |
Protein Interactions |
SOX2; APP; TINF2; POT1; UBC; IRF9; MEPCE; CDK9; RB1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ARID3B (ARP34275_T100) antibody |
Blocking Peptide |
For anti-ARID3B (ARP34275_T100) antibody is Catalog # AAP34275 (Previous Catalog # AAPP05625) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ARID3B |
Uniprot ID |
O95443 |
Protein Name |
AT-rich interactive domain-containing protein 3B |
Protein Accession # |
NP_006456 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_006465 |
Tested Species Reactivity |
Human |
Gene Symbol |
ARID3B |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 77%; Rat: 92% |
Image 1 | Human Thymus
| WB Suggested Anti-ARID3B Antibody Titration: 1.25ug/ml ELISA Titer: 1:62500 Positive Control: Human Thymus |
|