PAX9 Antibody - N-terminal region (ARP34270_P050)

Data Sheet
 
Product Number ARP34270_P050
Product Page www.avivasysbio.com/pax9-antibody-n-terminal-region-arp34270-p050.html
Name PAX9 Antibody - N-terminal region (ARP34270_P050)
Protein Size (# AA) 341 amino acids
Molecular Weight 36kDa
NCBI Gene Id 5083
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Paired box 9
Alias Symbols STHAG3
Peptide Sequence Synthetic peptide located within the following region: LPGAIGGSKPRVTTPTVVKHIRTYKQRDPGIFAWEIRDRLLADGVCDKYN
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Mensah,J.K., et al., (2004) J. Biol. Chem. 279 (7), 5924-5933
Description of Target PAX9 is a member of the paired box (PAX) family of transcription factors. Members of this gene family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. These genes play critical roles during fetal development and cancer growth. The specific function of the paired box gene 9 is unknown but it may involve development of stratified squamous epithelia as well as various organs and skeletal elements.
Protein Interactions KDM5B; ZNF440; ZNF580; GTF2A1L; TRIP4; FUBP3; NR0B2; TLE2; TLE1; SSX4; MSX1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-PAX9 (ARP34270_P050) antibody
Blocking Peptide For anti-PAX9 (ARP34270_P050) antibody is Catalog # AAP34270 (Previous Catalog # AAPP05620)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human PAX9
Uniprot ID P55771
Protein Name Paired box protein Pax-9
Sample Type Confirmation

PAX9 is supported by BioGPS gene expression data to be expressed in Jurkat

Protein Accession # NP_006185
Purification Affinity Purified
Nucleotide Accession # NM_006194
Tested Species Reactivity Human
Gene Symbol PAX9
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Image 1
Human Jurkat
WB Suggested Anti-PAX9 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysatePAX9 is supported by BioGPS gene expression data to be expressed in Jurkat
Image 2
Human Brain
Rabbit Anti-PAX9 Antibody
Catalog Number: ARP34270
Paraffin Embedded Tissue: Human Brain
Cellular Data: Neural Cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com