Product Number |
ARP34270_P050 |
Product Page |
www.avivasysbio.com/pax9-antibody-n-terminal-region-arp34270-p050.html |
Name |
PAX9 Antibody - N-terminal region (ARP34270_P050) |
Protein Size (# AA) |
341 amino acids |
Molecular Weight |
36kDa |
NCBI Gene Id |
5083 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Paired box 9 |
Alias Symbols |
STHAG3 |
Peptide Sequence |
Synthetic peptide located within the following region: LPGAIGGSKPRVTTPTVVKHIRTYKQRDPGIFAWEIRDRLLADGVCDKYN |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Mensah,J.K., et al., (2004) J. Biol. Chem. 279 (7), 5924-5933 |
Description of Target |
PAX9 is a member of the paired box (PAX) family of transcription factors. Members of this gene family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. These genes play critical roles during fetal development and cancer growth. The specific function of the paired box gene 9 is unknown but it may involve development of stratified squamous epithelia as well as various organs and skeletal elements. |
Protein Interactions |
KDM5B; ZNF440; ZNF580; GTF2A1L; TRIP4; FUBP3; NR0B2; TLE2; TLE1; SSX4; MSX1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-PAX9 (ARP34270_P050) antibody |
Blocking Peptide |
For anti-PAX9 (ARP34270_P050) antibody is Catalog # AAP34270 (Previous Catalog # AAPP05620) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human PAX9 |
Uniprot ID |
P55771 |
Protein Name |
Paired box protein Pax-9 |
Sample Type Confirmation |
PAX9 is supported by BioGPS gene expression data to be expressed in Jurkat |
Protein Accession # |
NP_006185 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_006194 |
Tested Species Reactivity |
Human |
Gene Symbol |
PAX9 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92% |
Image 1 | Human Jurkat
| WB Suggested Anti-PAX9 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: Jurkat cell lysatePAX9 is supported by BioGPS gene expression data to be expressed in Jurkat |
|
Image 2 | Human Brain
| Rabbit Anti-PAX9 Antibody Catalog Number: ARP34270 Paraffin Embedded Tissue: Human Brain Cellular Data: Neural Cells Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X |
|