| Product Number |
ARP34221_T100 |
| Product Page |
www.avivasysbio.com/cxorf6-antibody-n-terminal-region-arp34221-t100.html |
| Name |
CXORF6 Antibody - N-terminal region (ARP34221_T100) |
| Protein Size (# AA) |
701 amino acids |
| Molecular Weight |
74kDa |
| NCBI Gene Id |
10046 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Mastermind-like domain containing 1 |
| Alias Symbols |
CG1, F18, HYSP2, CXorf6 |
| Peptide Sequence |
Synthetic peptide located within the following region: LEELTKIQDPSPNELDLEKILGTKPEEPLVLDHPQATLSTTPKPSVQMSH |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Laporte,J., et al., (1997) Genomics 41 (3), 458-462 |
| Description of Target |
CXorf6 is a protein predicted based on an ORF found in chromosome 14 |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-MAMLD1 (ARP34221_T100) antibody |
| Blocking Peptide |
For anti-MAMLD1 (ARP34221_T100) antibody is Catalog # AAP34221 (Previous Catalog # AAPP05536) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human CXORF6 |
| Uniprot ID |
Q13495 |
| Protein Name |
Mastermind-like domain-containing protein 1 |
| Protein Accession # |
NP_005482 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_005491 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
MAMLD1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Dog, Guinea Pig, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Dog: 86%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 79%; Pig: 86%; Rabbit: 86%; Rat: 79% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-CXORF6 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate |
|
|
