ASPH Antibody - middle region (ARP34195_T100)

Data Sheet
 
Product Number ARP34195_T100
Product Page www.avivasysbio.com/asph-antibody-middle-region-arp34195-t100.html
Name ASPH Antibody - middle region (ARP34195_T100)
Protein Size (# AA) 758 amino acids
Molecular Weight 86kDa
NCBI Gene Id 444
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Aspartate beta-hydroxylase
Alias Symbols AAH, BAH, HAAH, JCTN, FDLAB, junctin, CASQ2BP1
Peptide Sequence Synthetic peptide located within the following region: ETNRKTDDPEQKAKVKKKKPKLLNKFDKTIKAELDAAEKLRKRGKIEEAV
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Xian,Z.H., et al., (2006) Mod. Pathol. 19 (2), 280-286
Description of Target ASPH is thought to play an important role in calcium homeostasis. Alternative splicing of this gene results in five transcript variants which vary in protein translation, the coding of catalytic domains, and tissue expression. Variation among these transcripts impacts their functions which involve roles in the calcium storage and release process in the endoplasmic and sarcoplasmic reticulum as well as hydroxylation of aspartic acid and asparagine in epidermal growth factor-like domains of various proteins.
Protein Interactions ASNA1; TARDBP; IQCB1; UBC; NOS2; Htt; APP; CUL3; SQSTM1; TRDN;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ASPH (ARP34195_T100) antibody
Blocking Peptide For anti-ASPH (ARP34195_T100) antibody is Catalog # AAP34195 (Previous Catalog # AAPP05510)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ASPH
Uniprot ID Q9Y4J0
Protein Name Aspartyl/asparaginyl beta-hydroxylase
Protein Accession # NP_004309
Purification Protein A purified
Nucleotide Accession # NM_004318
Tested Species Reactivity Human
Gene Symbol ASPH
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Image 1
Human Jurkat
WB Suggested Anti-ASPH Antibody Titration: 5.0ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com